Recombinant Mouse Chrac1 protein, His&Myc-tagged
Cat.No. : | Chrac1-3423M |
Product Overview : | Recombinant Mouse Chrac1 protein(Q9JKP8)(2-129aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 2-129aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 21.4 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | ADAAVGKEKCGDQRLVSLPLSRIRVIMKSSPEVSSINQEALVLTAKATELFVQYLATCSYRHGSGKAKKALTYSDLASTAEDSETLQFLADILPKKILASKYLKMLKEKREEEEDNEDDGSDLGEALA |
Gene Name | Chrac1 chromatin accessibility complex 1 [ Mus musculus ] |
Official Symbol | Chrac1 |
Synonyms | CHRAC1; chromatin accessibility complex 1; chromatin accessibility complex protein 1; CHRAC-1; YC-like protein 1; NF-YC-like protein; DNA polymerase epsilon subunit p15; YCL1; 2410152E03Rik; 2810406L04Rik; |
Gene ID | 93696 |
mRNA Refseq | NM_053068 |
Protein Refseq | NP_444298 |
◆ Recombinant Proteins | ||
CHRAC1-683R | Recombinant Rhesus Macaque CHRAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Chrac1-3423M | Recombinant Mouse Chrac1 protein, His&Myc-tagged | +Inquiry |
CHRAC1-1656M | Recombinant Mouse CHRAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CHRAC1-3756H | Recombinant Human CHRAC1 protein, GST-tagged | +Inquiry |
CHRAC1-3420M | Recombinant Mouse CHRAC1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CHRAC1-7525HCL | Recombinant Human CHRAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Chrac1 Products
Required fields are marked with *
My Review for All Chrac1 Products
Required fields are marked with *