Recombinant Human CHRAC1 protein, GST-tagged
| Cat.No. : | CHRAC1-3756H |
| Product Overview : | Recombinant Human CHRAC1 protein(62-131 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 10, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 62-131 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | RHGSGKEKKVLTYSDLANTAQQSETFQFLADILPKKILASKYLKMLKEEKREEDEENDNDNESDHDEADS |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | CHRAC1 chromatin accessibility complex 1 [ Homo sapiens ] |
| Official Symbol | CHRAC1 |
| Synonyms | CHRAC1; chromatin accessibility complex 1; chromatin accessibility complex protein 1; CHRAC15; histone fold protein CHRAC15; YCL1; histone-fold protein CHRAC15; DNA polymerase epsilon subunit p15; chromatin accessibility complex 15 kDa protein; CHARC1; CHARC15; CHRAC-1; CHRAC-15; |
| Gene ID | 54108 |
| mRNA Refseq | NM_017444 |
| Protein Refseq | NP_059140 |
| MIM | 607268 |
| UniProt ID | Q9NRG0 |
| ◆ Recombinant Proteins | ||
| CHRAC1-3756H | Recombinant Human CHRAC1 protein, GST-tagged | +Inquiry |
| CHRAC1-2095Z | Recombinant Zebrafish CHRAC1 | +Inquiry |
| CHRAC1-1265H | Recombinant Human CHRAC1 Protein, GST-Tagged | +Inquiry |
| Chrac1-3423M | Recombinant Mouse Chrac1 protein, His&Myc-tagged | +Inquiry |
| CHRAC1-1656M | Recombinant Mouse CHRAC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CHRAC1-7525HCL | Recombinant Human CHRAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CHRAC1 Products
Required fields are marked with *
My Review for All CHRAC1 Products
Required fields are marked with *
