Recombinant Mouse Cldn18 protein, His/SUMO-tagged Cldn18-35M

Recombinant Mouse Cldn18 protein, His/SUMO-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Cldn18 protein, His/SUMO-tagged

Recombinant Mouse Cldn18 protein, His/SUMO-tagged

Cldn18 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : Cldn18-35M
Product Overview : Recombinant Mouse Cldn18(1-264 aa) fused with His/SUMO tag was expressed in E.coli cell free.
Description : This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. This gene is a downstream target gene regulated by the T/EBP/NKX2.1 homeodomain transcription factor. Four alternatively spliced transcript variants resulted from alternative promoters and alternative splicing have been identified, which encode two lung-specific isoforms and two stomach-specific isoforms respectively. This gene is also expressed in colons, inner ear and skin, and its expression is increased in both experimental colitis and ulcerative colitis.
Source : E.coli cell free
Species : Mouse
Tag : His/SUMO
Form : Tris-based buffer,50% glycerol
Protein length : 1-264 aa
AA Sequence : MATTTCQVVGLLLSLLGLAGCIAATGMDMWSTQDLYDNPVTAVFQYEGLWRSCVQQSSGF TECRPYFTILGLPAMLQAVRALMIVGIVLGVIGILVSIFALKCIRIGSMDDSAKAKMTLT SGILFIISGICAIIGVSVFANMLVTNFWMSTANMYSGMGGMGGMVQTVQTRYTFGAALFV GWVAGGLTLIGGVMMCIACRGLTPDDSNFKAVSYHASGQNVAYRPGGFKASTGFGSNTRN KKIYDGGARTEDDEQSHPTKYDYV
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week.
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigradeor -80 centigrade.
Gene Name : Cldn18 claudin 18 [ Mus musculus ]
Official Symbol : Cldn18
Synonyms : claudin-18
Gene ID : 56492
mRNA Refseq : NM_001194921
Protein Refseq : NP_001181850
UniProt ID : P56857
Chromosome Location : 9; 9 E3-F1
Pathway : Cell adhesion molecules (CAMs), organism-specific biosystem; Leukocyte transendothelial migration, organism-specific biosystem; Tight junction, conserved biosystem
Function : protein binding; structural molecule activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy