Recombinant Mouse Gstm1 protein, His-sumostar-tagged
Cat.No. : | Gstm1-6444M |
Product Overview : | Recombinant Mouse Gstm1 protein(P10649)(2-218aa), fused with N-terminal His and sumostar tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His&SUMO |
Protein Length : | 2-218aa |
Tag : | N-His-sumostar |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | PMILGYWNVRGLTHPIRMLLEYTDSSYDEKRYTMGDAPDFDRSQWLNEKFKLGLDFPNLPYLIDGSHKITQSNAILRYLARKHHLDGETEEERIRADIVENQVMDTRMQLIMLCYNPDFEKQKPEFLKTIPEKMKLYSEFLGKRPWFAGDKVTYVDFLAYDILDQYRMFEPKCLDAFPNLRDFLARFEGLKKISAYMKSSRYIATPIFSKMAHWSNK |
Gene Name | Gstm1 glutathione S-transferase, mu 1 [ Mus musculus ] |
Official Symbol | Gstm1 |
Synonyms | GSTM1; glutathione S-transferase, mu 1; glutathione S-transferase Mu 1; pmGT10; GST 1-1; GST class-mu 1; glutathione S-transferase GT8.7; glutathione-S-transferase, mu 1; Gstb1; Gstb-1; |
Gene ID | 14862 |
mRNA Refseq | NM_010358 |
Protein Refseq | NP_034488 |
◆ Recombinant Proteins | ||
GSTM1-7496H | Recombinant Human GSTM1 protein, His-tagged | +Inquiry |
Gstm1-1325M | Active Recombinant Mouse Glutathione S-Transferase, Mu 1 | +Inquiry |
Gstm1-6443M | Recombinant Mouse Gstm1 protein, His-tagged | +Inquiry |
Gstm1-6444M | Recombinant Mouse Gstm1 protein, His-sumostar-tagged | +Inquiry |
GSTM1-4415H | Recombinant Human GSTM1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTM1-5713HCL | Recombinant Human GSTM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gstm1 Products
Required fields are marked with *
My Review for All Gstm1 Products
Required fields are marked with *
0
Inquiry Basket