Recombinant Mouse Hbb-bt Protein, Full Length, C-Myc/DDK tagged
| Cat.No. : | Hbb-bt-14MFL |
| Product Overview : | Purified recombinant protein of Mouse hemoglobin, beta adult major chain (Hbb-b1), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Protein Length : | Full Length |
| Description : | This gene encodes a beta polypeptide chain found in adult hemoglobin, which consists of a tetramer of two alpha chains and two beta chains, and which functions in the transport of oxygen to various peripheral tissues. This gene is one of a cluster of beta-hemoglobin genes that are distally regulated by a locus control region, and which are organized along the chromosome in the order of their developmental expression. In mouse, two major strain-specific haplotypes of the beta-globin gene cluster are found - a "single" haplotype found in C57BL/-type strains, which includes two highly similar adult beta-globin genes, beta s and beta t, and a "diffuse" haplotype found in strains such as BALB/c and 129Sv, which includes two somewhat diverse adult beta-globin genes, beta-major and beta-minor. This gene represents the beta t adult gene found in the "single" haplotype. Primary chromosome 7 of the mouse reference genome assembly, which is derived from C57BL/6 strain mice, represents the "single" haplotype, while the "diffuse" haplotype is represented in the reference genome collection by the BALB/c strain alternate contig, NT_095534.1. [provided by RefSeq, May 2013] |
| Molecular Mass : | 16.2 kDa |
| AA Sequence : | MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKVKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVAAALAHKYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions. |
| Concentration : | > 0.05 μg/μL as determined by microplate BCA method |
| Storage Buffer : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Gene Name | Hbb-bt hemoglobin, beta adult t chain [ Mus musculus (house mouse) ] |
| Official Symbol | Hbb-bt |
| Synonyms | Hbb-bt; hemoglobin, beta adult t chain; Beta-t; hemoglobin, beta adult t chain; beta t |
| Gene ID | 101488143 |
| mRNA Refseq | NM_008220 |
| Protein Refseq | NP_032246 |
| UniProt ID | A8DUK4 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hbb-bt Products
Required fields are marked with *
My Review for All Hbb-bt Products
Required fields are marked with *
