Recombinant Mouse Hbb-bt Protein, Full Length, C-Myc/DDK tagged

Cat.No. : Hbb-bt-14MFL
Product Overview : Purified recombinant protein of Mouse hemoglobin, beta adult major chain (Hbb-b1), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : DDK&Myc
Protein Length : Full Length
Description : This gene encodes a beta polypeptide chain found in adult hemoglobin, which consists of a tetramer of two alpha chains and two beta chains, and which functions in the transport of oxygen to various peripheral tissues. This gene is one of a cluster of beta-hemoglobin genes that are distally regulated by a locus control region, and which are organized along the chromosome in the order of their developmental expression. In mouse, two major strain-specific haplotypes of the beta-globin gene cluster are found - a "single" haplotype found in C57BL/-type strains, which includes two highly similar adult beta-globin genes, beta s and beta t, and a "diffuse" haplotype found in strains such as BALB/c and 129Sv, which includes two somewhat diverse adult beta-globin genes, beta-major and beta-minor. This gene represents the beta t adult gene found in the "single" haplotype. Primary chromosome 7 of the mouse reference genome assembly, which is derived from C57BL/6 strain mice, represents the "single" haplotype, while the "diffuse" haplotype is represented in the reference genome collection by the BALB/c strain alternate contig, NT_095534.1. [provided by RefSeq, May 2013]
Molecular Mass : 16.2 kDa
AA Sequence : MVHLTDAEKAAVSGLWGKVNADEVGGEALGRLLVVYPWTQRYFDSFGDLSSASAIMGNAKVKAHGKKVITAFNDGLNHLDSLKGTFASLSELHCDKLHVDPENFRLLGNMIVIVLGHHLGKDFTPAAQAAFQKVVAGVAAALAHKYHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Notes : For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions.
Concentration : > 0.05 μg/μL as determined by microplate BCA method
Storage Buffer : 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Gene Name Hbb-bt hemoglobin, beta adult t chain [ Mus musculus (house mouse) ]
Official Symbol Hbb-bt
Synonyms Hbb-bt; hemoglobin, beta adult t chain; Beta-t; hemoglobin, beta adult t chain; beta t
Gene ID 101488143
mRNA Refseq NM_008220
Protein Refseq NP_032246
UniProt ID A8DUK4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Hbb-bt Products

Required fields are marked with *

My Review for All Hbb-bt Products

Required fields are marked with *

0
cart-icon
0
compare icon