Recombinant Mouse HNRNPA2B1 Protein (1-353 aa), His-SUMO-tagged
Cat.No. : | HNRNPA2B1-2196M |
Product Overview : | Recombinant Mouse HNRNPA2B1 Protein (1-353 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-353 aa |
Description : | Heterogeneous nuclear ribonucleoprotein (hnRNP) that associates with nascent pre-mRNAs, packaging them into hnRNP particles. The hnRNP particle arrangement on nascent hnRNA is non-random and sequence-dependent and serves to condense and stabilize the transcripts and minimize tangling and knotting. Packaging plays a role in various processes such as transcription, pre-mRNA processing, RNA nuclear export, subcellular location, mRNA translation and stability of mature mRNAs. Forms hnRNP particles with at least 20 other different hnRNP and heterogeneous nuclear RNA in the nucleus. Involved in transport of specific mRNAs to the cytoplasm in oligodendrocytes and neurons: acts by specifically recognizing and binding the A2RE (21 nucleotide hnRNP A2 response element) or the A2RE11 (derivative 11 nucleotide oligonucleotide) sequence motifs present on some mRNAs, and promotes their transport to the cytoplasm. Specifically binds single-stranded telomeric DNA sequences, protecting telomeric DNA repeat against endonuclease digestion. Also binds other RNA molecules, such as primary miRNA (pri-miRNAs): acts as a nuclear 'reader' of the N6-methyladenosine (m6A) mark by specifically recognizing and binding a subset of nuclear m6A-containing pri-miRNAs. Binding to m6A-containing pri-miRNAs promotes pri-miRNA processing by enhancing binding of DGCR8 to pri-miRNA transcripts. Involved in miRNA sorting into exosomes following sumoylation, possibly by binding (m6A)-containing pre-miRNAs. Acts as a regulator of efficiency of mRNA splicing, possibly by binding to m6A-containing pre-mRNAs. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.4 kDa |
AA Sequence : | MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Hnrnpa2b1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Mus musculus ] |
Official Symbol | HNRNPA2B1 |
Synonyms | HNRNPA2B1; hnRNP A2/B1; hnRNP A2 / hnRNP B1; Hnrpa2; hnrnp-A; Hnrpa2b1; 9130414A06Rik; |
Gene ID | 53379 |
mRNA Refseq | NM_016806 |
Protein Refseq | NP_058086 |
UniProt ID | O88569 |
◆ Recombinant Proteins | ||
HNRNPA2B1-2037HFL | Recombinant Full Length Human HNRNPA2B1, Flag-tagged | +Inquiry |
HNRNPA2B1-3044H | Recombinant Human HNRNPA2B1 protein, His-B2M-tagged | +Inquiry |
HNRNPA2B1-2196M | Recombinant Mouse HNRNPA2B1 Protein (1-353 aa), His-SUMO-tagged | +Inquiry |
HNRNPA2B1-3045H | Recombinant Human HNRNPA2B1 protein, His-tagged | +Inquiry |
Hnrnpa2b1-3046M | Recombinant Mouse Hnrnpa2b1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPA2B1-334HCL | Recombinant Human HNRNPA2B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPA2B1 Products
Required fields are marked with *
My Review for All HNRNPA2B1 Products
Required fields are marked with *
0
Inquiry Basket