Recombinant Human HNRNPA2B1 protein(11-320 aa), C-His-tagged
Cat.No. : | HNRNPA2B1-2699H |
Product Overview : | Recombinant Human HNRNPA2B1 protein(P22626)(11-320 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 11-320 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 36 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | ERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGN |
Gene Name | HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Homo sapiens ] |
Official Symbol | HNRNPA2B1 |
Synonyms | HNRNPA2B1; heterogeneous nuclear ribonucleoprotein A2/B1; HNRPA2B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2 / hnRNP B1; nuclear ribonucleoprotein particle A2 protein; RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; FLJ22720; DKFZp779B0244; |
Gene ID | 3181 |
mRNA Refseq | NM_002137 |
Protein Refseq | NP_002128 |
MIM | 600124 |
UniProt ID | P22626 |
◆ Recombinant Proteins | ||
HNRNPA2B1-3045H | Recombinant Human HNRNPA2B1 protein, His-tagged | +Inquiry |
HNRNPA2B1-3633H | Recombinant Human HNRNPA2B1 protein, His-tagged | +Inquiry |
HNRNPA2B1-4911H | Recombinant Human HNRNPA2B1 Protein, GST-tagged | +Inquiry |
HNRNPA2B1-2535R | Recombinant Rat HNRNPA2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HNRNPA2B1-1761B | Recombinant Bovine HNRNPA2B1 Protein (1-341 aa), His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HNRNPA2B1-334HCL | Recombinant Human HNRNPA2B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HNRNPA2B1 Products
Required fields are marked with *
My Review for All HNRNPA2B1 Products
Required fields are marked with *
0
Inquiry Basket