Recombinant Human HNRNPA2B1 protein(11-320 aa), C-His-tagged
| Cat.No. : | HNRNPA2B1-2699H |
| Product Overview : | Recombinant Human HNRNPA2B1 protein(P22626)(11-320 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 11-320 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 36 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | ERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGNYNDFGNYNQQPSNYGPMKSGN |
| Gene Name | HNRNPA2B1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Homo sapiens ] |
| Official Symbol | HNRNPA2B1 |
| Synonyms | HNRNPA2B1; heterogeneous nuclear ribonucleoprotein A2/B1; HNRPA2B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2 / hnRNP B1; nuclear ribonucleoprotein particle A2 protein; RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; FLJ22720; DKFZp779B0244; |
| Gene ID | 3181 |
| mRNA Refseq | NM_002137 |
| Protein Refseq | NP_002128 |
| MIM | 600124 |
| UniProt ID | P22626 |
| ◆ Recombinant Proteins | ||
| HNRNPA2B1-2699H | Recombinant Human HNRNPA2B1 protein(11-320 aa), C-His-tagged | +Inquiry |
| HNRNPA2B1-2037HFL | Recombinant Full Length Human HNRNPA2B1, Flag-tagged | +Inquiry |
| HNRNPA2B1-5325H | Recombinant Human HNRNPA2B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HNRNPA2B1-3633H | Recombinant Human HNRNPA2B1 protein, His-tagged | +Inquiry |
| HNRNPA2B1-2535R | Recombinant Rat HNRNPA2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPA2B1-334HCL | Recombinant Human HNRNPA2B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HNRNPA2B1 Products
Required fields are marked with *
My Review for All HNRNPA2B1 Products
Required fields are marked with *
