Recombinant Mouse Hnrnpa2b1 protein, His-SUMO & Myc-tagged
| Cat.No. : | Hnrnpa2b1-3047M |
| Product Overview : | Recombinant Mouse Hnrnpa2b1 protein(O88569)(1-353aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His&Myc&SUMO |
| Protein Length : | 1-353aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 57.4 kDa |
| AA Sequence : | MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Hnrnpa2b1 heterogeneous nuclear ribonucleoprotein A2/B1 [ Mus musculus ] |
| Official Symbol | Hnrnpa2b1 |
| Synonyms | HNRNPA2B1; heterogeneous nuclear ribonucleoprotein A2/B1; heterogeneous nuclear ribonucleoproteins A2/B1; hnRNP A2/B1; hnRNP A2 / hnRNP B1; heterogenous nuclear ribonucleoprotein A2/B1; Hnrpa2; hnrnp-A; Hnrpa2b1; 9130414A06Rik; |
| Gene ID | 53379 |
| mRNA Refseq | NM_016806 |
| Protein Refseq | NP_058086 |
| ◆ Recombinant Proteins | ||
| HNRNPA2B1-4258M | Recombinant Mouse HNRNPA2B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HNRNPA2B1-786H | Recombinant Human HNRNPA2B1 protein, His&Myc-tagged | +Inquiry |
| HNRNPA2B1-4911H | Recombinant Human HNRNPA2B1 Protein, GST-tagged | +Inquiry |
| Hnrnpa2b1-3419M | Recombinant Mouse Hnrnpa2b1 Protein, Myc/DDK-tagged | +Inquiry |
| HNRNPA2B1-2880R | Recombinant Rat HNRNPA2B1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HNRNPA2B1-334HCL | Recombinant Human HNRNPA2B1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Hnrnpa2b1 Products
Required fields are marked with *
My Review for All Hnrnpa2b1 Products
Required fields are marked with *
