Recombinant Mouse IgG1Fc protein
| Cat.No. : | IgG1Fc-14M |
| Product Overview : | Recombinant Human SHANK2 protein(Q9UPA5)(Met871-Val1000), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Met871-Val1000 |
| Tag : | C-His |
| Form : | Phosphate buffered saline |
| Molecular Mass : | 16 kDa |
| Storage : | Store at -20°C to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MLKFTRSLSMPDTSEDIPPPPQSVPPSPPPPSPTTYNCPKSPTPRVYGTIKPAFNQNSAAKVSPATRSDTVATMMREKGMYFRRELDRYSLDSEDLYSRNAGPQANFRNKRGQMPENPYSEVGKIASKAV |
| Gene Name | SHANK2 SH3 and multiple ankyrin repeat domains 2 [ Homo sapiens ] |
| Official Symbol | SHANK2 |
| Synonyms | SHANK; AUTS17; CORTBP1; CTTNBP1; ProSAP1; SPANK-3 |
| Gene ID | 22941 |
| mRNA Refseq | NM_133266.3 |
| Protein Refseq | NP_573573.2 |
| MIM | 603290 |
| UniProt ID | Q9UPX8 |
| ◆ Recombinant Proteins | ||
| IgG1Fc-09H | Active Recombinant Human IgG1Fc protein, His-tagged | +Inquiry |
| IgG1Fc-017H | Active Recombinant Human IgG1Fc protein | +Inquiry |
| IgG1Fc-0247M | Recombinant Mouse IgG1Fc protein, Avi-tagged, Biotinylated | +Inquiry |
| IgG1Fc-13H | Recombinant Human IgG1Fc protein | +Inquiry |
| IgG1Fc-10M | Active Recombinant Mouse IgG1Fc protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IgG1Fc Products
Required fields are marked with *
My Review for All IgG1Fc Products
Required fields are marked with *
