Recombinant Mouse Irx3 protein
Cat.No. : | Irx3-5308M |
Product Overview : | Recombinant Mouse Irx3 protein(P81067)(462-507 aa) was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | Non |
Protein Length : | 462-507 aa |
Form : | Tris/PBS-based buffer, 6% Trehalose. |
AASequence : | EPESGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSSS |
Purity : | >85% (SDS-PAGE) |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Irx3 Iroquois related homeobox 3 (Drosophila) [ Mus musculus ] |
Official Symbol | Irx3 |
Synonyms | IRX3; Iroquois related homeobox 3 (Drosophila); iroquois-class homeodomain protein IRX-3; homeodomain protein IRXB1; iroquois homeobox protein 3; AI894186; |
Gene ID | 16373 |
mRNA Refseq | NM_001253822 |
Protein Refseq | NP_001240751 |
◆ Recombinant Proteins | ||
IRX3-8319M | Recombinant Mouse IRX3 Protein | +Inquiry |
Irx3-5308M | Recombinant Mouse Irx3 protein | +Inquiry |
Irx3-5312M | Recombinant Mouse Irx3 protein | +Inquiry |
IRX3-4615M | Recombinant Mouse IRX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRX3-5751HF | Recombinant Full Length Human IRX3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRX3-874HCL | Recombinant Human IRX3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Irx3 Products
Required fields are marked with *
My Review for All Irx3 Products
Required fields are marked with *
0
Inquiry Basket