Recombinant Mouse Irx3 protein
| Cat.No. : | Irx3-5312M |
| Product Overview : | Recombinant Mouse Irx3 protein(P81067)(462-507 aa) was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | Mammalian cells |
| Tag : | Non |
| Protein Length : | 462-507 aa |
| Form : | Tris/PBS-based buffer, 6% Trehalose. |
| AASequence : | EPESGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSSS |
| Purity : | >85% (SDS-PAGE) |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Irx3 Iroquois related homeobox 3 (Drosophila) [ Mus musculus ] |
| Official Symbol | Irx3 |
| Synonyms | IRX3; Iroquois related homeobox 3 (Drosophila); iroquois-class homeodomain protein IRX-3; homeodomain protein IRXB1; iroquois homeobox protein 3; AI894186; |
| Gene ID | 16373 |
| mRNA Refseq | NM_001253822 |
| Protein Refseq | NP_001240751 |
| ◆ Recombinant Proteins | ||
| Irx3-5312M | Recombinant Mouse Irx3 protein | +Inquiry |
| IRX3-5751HF | Recombinant Full Length Human IRX3 Protein, GST-tagged | +Inquiry |
| IRX3-8319M | Recombinant Mouse IRX3 Protein | +Inquiry |
| IRX3-5024H | Recombinant Human IRX3 Protein, GST-tagged | +Inquiry |
| Irx3-5310M | Recombinant Mouse Irx3 protein, Avi-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRX3-874HCL | Recombinant Human IRX3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Irx3 Products
Required fields are marked with *
My Review for All Irx3 Products
Required fields are marked with *
