Recombinant Mouse Irx3 protein

• Cat.No.: Irx3-5312M
• Product Overview: Recombinant Mouse Irx3 protein(P81067)(462-507 aa) was expressed in Mammalian cells.

Specification

• Species: Mouse
• Source: Mammalian cells
• Tag: Non
• Protein Length: 462-507 aa
• Form: Tris/PBS-based buffer, 6% Trehalose.
• AASequence: EPESGTDRCSALEVEKKLLKTAFQPVPRRPQNHLDAALVLSALSSS
• Purity: >85% (SDS-PAGE)
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Irx3 Iroquois related homeobox 3 (Drosophila) [ Mus musculus ]
• Official Symbol: Irx3
• Synonyms: IRX3; Iroquois related homeobox 3 (Drosophila); iroquois-class homeodomain protein IRX-3; homeodomain protein IRXB1; iroquois homeobox protein 3; AI894186
• Gene ID: 16373
• mRNA Refseq: NM_001253822
• Protein Refseq: NP_001240751