Recombinant Mouse Mmp14 Protein, Catalytic Domain, His tagged

• Cat.No.: Mmp14-9912M
• Product Overview: Recombinant Mouse MMP-14 (Catalytic Domain) with His tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 112-291 aa
• Description: This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme. Mice lacking the encoded protein exhibit craniofacial dysmorphism, arthritis, osteopenia, dwarfism, and fibrosis of soft tissues.
• Form: Sterile 50mM Tris, pH8.0, 300mM NaCl
• Molecular Mass: 21 kDa
• AASequence: MYAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTHHHHHHHH
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 0.6 mg/mL by BCA

Gene Information

• Gene Name: Mmp14 matrix metallopeptidase 14 (membrane-inserted) [ Mus musculus (house mouse) ]
• Official Symbol: MMP14
• Synonyms: MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase-14; MMP-14; MMP-X1; MT1MMP; MTMMP1; MT-MMP 1; Membrane type 1-MMP; type 1 matrix metalloprotease 14; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); MT1-MMP; AI325305; MT-MMP-1
• Gene ID: 17387
• mRNA Refseq: NM_008608
• Protein Refseq: NP_032634
• UniProt ID: O08645