Recombinant Mouse Mmp14 Protein, His-tagged

• Cat.No.: Mmp14-9911M
• Product Overview: Recombinant Mouse Mmp14 Protein(P53690)(112-582 aa), fused with C-terminal His Tag, was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 112-582 aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
• Molecular Mass: 60.6 kDa
• AASequence: YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Mmp14 matrix metallopeptidase 14 (membrane-inserted) [ Mus musculus ]
• Official Symbol: Mmp14
• Synonyms: MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase-14; MMP-14; MMP-X1; MT1MMP; MTMMP1; MT-MMP 1; Membrane type 1-MMP; type 1 matrix metalloprotease 14; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); MT1-MMP; AI325305; MT-MMP-1
• Gene ID: 17387
• mRNA Refseq: NM_008608
• Protein Refseq: NP_032634