Recombinant Mouse Mmp14 Protein, His-tagged
| Cat.No. : | Mmp14-9911M |
| Product Overview : | Recombinant Mouse Mmp14 Protein(P53690)(112-582 aa), fused with C-terminal His Tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 112-582 aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Molecular Mass : | 60.6 kDa |
| AASequence : | YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV |
| Purity : | Greater than 95% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | Mmp14 matrix metallopeptidase 14 (membrane-inserted) [ Mus musculus ] |
| Official Symbol | Mmp14 |
| Synonyms | MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase-14; MMP-14; MMP-X1; MT1MMP; MTMMP1; MT-MMP 1; Membrane type 1-MMP; type 1 matrix metalloprotease 14; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); MT1-MMP; AI325305; MT-MMP-1; |
| Gene ID | 17387 |
| mRNA Refseq | NM_008608 |
| Protein Refseq | NP_032634 |
| ◆ Recombinant Proteins | ||
| MMP14-3296R | Recombinant Rhesus monkey MMP14 protein, His-tagged | +Inquiry |
| MMP14-657H | Recombinant Human MMP14 protein, His-tagged | +Inquiry |
| MMP14-2790R | Recombinant Rhesus monkey MMP14 Protein, His-tagged | +Inquiry |
| Mmp14-4098M | Recombinant Mouse Mmp14 Protein, Myc/DDK-tagged | +Inquiry |
| MMP14-3649H | Recombinant Human MMP14 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP14-243HKCL | Human MMP14 Knockdown Cell Lysate | +Inquiry |
| MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mmp14 Products
Required fields are marked with *
My Review for All Mmp14 Products
Required fields are marked with *
