Recombinant Mouse Mmp14 protein, His-tagged
Cat.No. : | Mmp14-9911M |
Product Overview : | Recombinant Mouse Mmp14(aa 112-582) fused with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | aa 112-582 |
Form : | Tris-based buffer,50% glycerol |
AA Sequence : | YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGH EKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGN DIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPT KMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMD GYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLP TDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSD EVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDE EGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV |
Purity : | >90% ( SDS-PAGE ) |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. |
Gene Name | Mmp14 matrix metallopeptidase 14 (membrane-inserted) [ Mus musculus ] |
Official Symbol | Mmp14 |
Synonyms | MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase-14; MMP-14; MMP-X1; MT1MMP; MTMMP1; MT-MMP 1; Membrane type 1-MMP; type 1 matrix metalloprotease 14; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); MT1-MMP; AI325305; MT-MMP-1; |
Gene ID | 17387 |
mRNA Refseq | NM_008608 |
Protein Refseq | NP_032634 |
MIM | |
UniProt ID | P53690 |
Chromosome Location | 14 C2; 14 27.79 cM |
Pathway | GnRH signaling pathway, organism-specific biosystem; GnRH signaling pathway, conserved biosystem; Matrix Metalloproteinases, organism-specific biosystem; |
Function | calcium ion binding; hydrolase activity; integrin binding; metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activator activity; peptidase activity; sequence-specific DNA binding transcription factor activity; zinc ion binding; |
◆ Recombinant Proteins | ||
MMP14-4576H | Recombinant Human MMP14 Protein (Pro316-Gly511), N-His tagged | +Inquiry |
MMP14-1418H | Recombinant Human MMP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP14-9909M | Recombinant Mouse MMP14 Protein | +Inquiry |
MMP14-3369R | Recombinant Rat MMP14 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMP14-39H | Active Recombinant Human MMP14, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mmp14 Products
Required fields are marked with *
My Review for All Mmp14 Products
Required fields are marked with *