"Mmp14" Related Products

Expand
Expand
Expand

Recombinant Mouse Mmp14 protein, His-tagged

Cat.No.: Mmp14-9911M
Product Overview: Recombinant Mouse Mmp14(aa 112-582) fused with His tag was expressed in E. coli.
Source: E. coli
Species: Mouse
Tag: His
Form: Tris-based buffer,50% glycerol
Protein length: aa 112-582
AA Sequence: YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGH EKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGN DIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPT KMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMD GYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLP TDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSD EVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDE EGSGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPKRLLYCQRSLLDKV
Purity: >90% ( SDS-PAGE )
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade.
Gene Name: Mmp14 matrix metallopeptidase 14 (membrane-inserted) [ Mus musculus ]
Official Symbol: Mmp14
Synonyms: MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase-14; MMP-14; MMP-X1; MT1MMP; MTMMP1; MT-MMP 1; Membrane type 1-MMP; type 1 matrix metalloprotease 14; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); MT1-MMP; AI325305; MT-MMP-1;
Gene ID: 17387
mRNA Refseq: NM_008608
Protein Refseq: NP_032634
MIM:
UniProt ID: P53690
Chromosome Location: 14 C2; 14 27.79 cM
Pathway: GnRH signaling pathway, organism-specific biosystem; GnRH signaling pathway, conserved biosystem; Matrix Metalloproteinases, organism-specific biosystem;
Function: calcium ion binding; hydrolase activity; integrin binding; metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activator activity; peptidase activity; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.