Recombinant Human MMP14 protein, His-tagged
| Cat.No. : | MMP14-3649H |
| Product Overview : | Recombinant Human MMP14 protein(356-475 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 356-475 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | PIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT |
| Gene Name | MMP14 matrix metallopeptidase 14 (membrane-inserted) [ Homo sapiens ] |
| Official Symbol | MMP14 |
| Synonyms | MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase 14 (membrane inserted); matrix metalloproteinase-14; membrane type 1 metalloprotease; MT1 MMP; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); 1; MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; MT1-MMP; MT-MMP 1; |
| Gene ID | 4323 |
| mRNA Refseq | NM_004995 |
| Protein Refseq | NP_004986 |
| MIM | 600754 |
| UniProt ID | P50281 |
| ◆ Recombinant Proteins | ||
| MMP14-84H | Recombinant Human MMP14 protein | +Inquiry |
| MMP14-4576H | Recombinant Human MMP14 Protein (Pro316-Gly511), N-His tagged | +Inquiry |
| MMP14-162H | Active Recombinant Human MMP14 | +Inquiry |
| MMP14-1837H | Active Recombinant Human MMP14 protein | +Inquiry |
| MMP14-33H | Active Recombinant Human MMP14 protein, mutation C127S | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MMP14-4279HCL | Recombinant Human MMP14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MMP14 Products
Required fields are marked with *
My Review for All MMP14 Products
Required fields are marked with *
