Recombinant Human MMP14 protein, His-tagged
Cat.No. : | MMP14-3649H |
Product Overview : | Recombinant Human MMP14 protein(356-475 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 356-475 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | PIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT |
Gene Name | MMP14 matrix metallopeptidase 14 (membrane-inserted) [ Homo sapiens ] |
Official Symbol | MMP14 |
Synonyms | MMP14; matrix metallopeptidase 14 (membrane-inserted); matrix metalloproteinase 14 (membrane inserted); matrix metalloproteinase-14; membrane type 1 metalloprotease; MT1 MMP; membrane-type matrix metalloproteinase 1; membrane-type-1 matrix metalloproteinase; matrix metalloproteinase 14 (membrane-inserted); 1; MMP-14; MMP-X1; MT-MMP; MT1MMP; MTMMP1; MT1-MMP; MT-MMP 1; |
Gene ID | 4323 |
mRNA Refseq | NM_004995 |
Protein Refseq | NP_004986 |
MIM | 600754 |
UniProt ID | P50281 |
◆ Recombinant Proteins | ||
ADAM15-276H | Recombinant Human ADAM15 Protein, GST-tagged | +Inquiry |
ADAM15-3697H | Recombinant Human ADAM15 protein, His-tagged | +Inquiry |
ADAM15-1717H | Recombinant Human ADAM15 protein, His-tagged | +Inquiry |
ADAM15-948M | Active Recombinant Mouse ADAM15 Protein, His-tagged | +Inquiry |
ADAM15-1186H | Recombinant Human ADAM15 Protein (207-452 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAM15-1820MCL | Recombinant Mouse ADAM15 cell lysate | +Inquiry |
ADAM15-2808HCL | Recombinant Human ADAM15 cell lysate | +Inquiry |
ADAM15-001HCL | Recombinant Human ADAM15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAM15 Products
Required fields are marked with *
My Review for All ADAM15 Products
Required fields are marked with *
0
Inquiry Basket