Recombinant Mouse PDCD1LG2 Protein

• Cat.No.: PDCD1LG2-718M
• Product Overview: Recombinant Mouse PDCD1LG2 protein without tag was expressed in HEK293.

Specification

• Species: Mouse
• Source: HEK293
• Protein Length: 247
• Description: Acts upstream of or within negative regulation of T cell proliferation and positive regulation of T cell proliferation. Predicted to be located in plasma membrane. Predicted to be integral component of membrane. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including alimentary system epithelium; forebrain; nose; retina; and skin. Orthologous to human PDCD1LG2 (programmed cell death 1 ligand 2).
• Form: Lyophilized
• Molecular Mass: 24.4 kDa
• AA Sequence: MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPRTWPLHVFIPACTIALIFLAIVIIQRKRI
• Purity: > 98%
• Applications: WB; ELISA; FACS; FC
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: Pdcd1lg2 programmed cell death 1 ligand 2 [ Mus musculus (house mouse) ]
• Official Symbol: PDCD1LG2
• Synonyms: PDCD1LG2; programmed cell death 1 ligand 2; PD-1 ligand 2; PDCD1 ligand 2; butyrophilin B7-DC; butyrophilin-like protein; programmed death ligand 2; Btdc; B7-DC; PD-L2; F730015O22Rik; MGC124039; MGC124040
• Gene ID: 58205
• mRNA Refseq: NM_021396
• Protein Refseq: NP_067371
• UniProt ID: Q9WUL5