Recombinant Full Length Mouse SIAE Protein, His tagged
| Cat.No. : | SIAE-15119M |
| Availability | January 11, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 22-541 aa |
| Description : | Predicted to enable sialate O-acetylesterase activity. Predicted to be involved in carbohydrate metabolic process and regulation of immune system process. Located in lysosome. Is expressed in several structures, including abdominal fat pad; central nervous system; genitourinary system; immune system; and yolk sac. Human ortholog(s) of this gene implicated in autoimmune disease. Orthologous to human SIAE (sialic acid acetylesterase). |
| Molecular Mass : | 60 kDa |
| AA Sequence : | AGIGFRFASYIDNYMVLQKEPSGAVIWGFGTPGATVTVTLCQGQETIMKKVTSVKEPSNTWMVVLDPMKPGGPFEVMAQQTLGTMNFTLRVHDVLFGDVWLCSGQSNMQMTVSQIFNASKELSDTAAYQSVRIFSVSLIQSEEELDDLTEVDLSWSKPTAGNLGHGNFTYMSAVCWLFGRYLYDTLQYPIGLVSSSWGGTYIEVWSSRRTLKACGVPNTRDERVGQPEIKPMRNECNSEESSCPFRVVPSVRVTGPTRHSVLWNAMIHPLQNMTLKGVVWYQGESNADYNRDLYTCMFPELIEDWRQTFHYGSQGQTDRFFPFGFVQLSSYMLKNSSDYGFPEIRWHQTADFGHVPNPKMPNTFMAVAIDLCDRDSPFGSIHPRDKQTVAYRLHLGARAVAYGEKNLTFQGPLPKKIELLASNGLLNLTYDQEIQVQMQDNKTFEISCCSDRHCKWLPAPVNTFSTQTLILDLNACLGTVVAVRYAWTTWPCEYKQCAVYHTSSMLPAPPFIAQISHRGIHHHHHHHH |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Concentration : | 0.22 mg/mL by BCA |
| Publications : |
Pregnancy enables antibody protection against intracellular infection (2022)
|
| Gene Name | Siae sialic acid acetylesterase [ Mus musculus (house mouse) ] |
| Official Symbol | SIAE |
| Synonyms | SIAE; sialic acid acetylesterase; sialate O-acetylesterase; clone 165; yolk sac gene 2; yolk sac protein 2; sialic acid-specific 9-O-acetylesterase; LSE; Ysg2 |
| Gene ID | 22619 |
| mRNA Refseq | NM_011734 |
| Protein Refseq | NP_035864 |
| UniProt ID | P70665 |
| ◆ Recombinant Proteins | ||
| SIAE-694H | Recombinant Human SIAE Protein, His/GST-tagged | +Inquiry |
| SIAE-10HFL | Active Recombinant Full Length Human sialic acid acetylesterase protein, His tagged | +Inquiry |
| Siae-5873M | Recombinant Mouse Siae Protein, Myc/DDK-tagged | +Inquiry |
| SIAE-5931H | Recombinant Human SIAE Protein (Ala22-Pro244), N-GST tagged | +Inquiry |
| SIAE-3872Z | Recombinant Zebrafish SIAE | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SIAE-001HCL | Recombinant Human SIAE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Siae Products
Required fields are marked with *
My Review for All Siae Products
Required fields are marked with *
