Recombinant Mouse SRPX2 Protein (26-468 aa), His-Myc-tagged
Cat.No. : | SRPX2-2759M |
Product Overview : | Recombinant Mouse SRPX2 Protein (26-468 aa) is produced by Baculovirus expression system. This protein is fused with a 10xHis tag at the N-terminal and a Myc tag at the C-terminal. Research Area: Neuroscience. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 26-468 aa |
Description : | Acts as a ligand for the urokinase plasminogen activator surface receptor. Plays a role in angiogenesis by inducing endothelial cell migration and the formation of vascular network (cords). Involved in cellular migration and adhesion. Increases the phosphorylation levels of FAK. Interacts with and increases the mitogenic activity of HGF. Promotes synapse formation. Required for ultrasonic vocalizations. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 54.5 kDa |
AA Sequence : | WYAGSGYSPDESYNEVYAEEVPAARARALDYRVPRWCYTLNIQDGEATCYSPRGGNYHSSLGTRCELSCDRGFRLIGRKSVQCLPSRRWSGTAYCRQIRCHTLPFITSGTYTCTNGMLLDSRCDYSCSSGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRGPEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPILKPPQHGYLTCSSAGDNYGAICEYHCDGGYERQGTPSRVCQSSRQWSGTPPVCTPMKINVNVNSAAGLLDQFYEKQRLLIVSAPDPSNRYYKMQISMLQQSTCGLDLRHVTIIELVGQPPQEVGRIREQQLSAGIIEELRQFQRLTRSYFNMVLIDKQGIDRERYMEPVTPEEIFTFIDDYLLSNEELARRVEQRDLCE |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Srpx2 sushi-repeat-containing protein, X-linked 2 [ Mus musculus ] |
Official Symbol | SRPX2 |
Synonyms | SRPX2; sushi-repeat containing protein; SRP; SRPUL; 1110039C07Rik; |
Gene ID | 68792 |
mRNA Refseq | NM_001083895 |
Protein Refseq | NP_001077364 |
UniProt ID | Q8R054 |
◆ Recombinant Proteins | ||
SRPX2-20H | Recombinant Human SRPX2 protein, GST-tagged | +Inquiry |
SRPX2-8123HFL | Recombinant Full Length Human SRPX2 protein, Flag-tagged | +Inquiry |
SRPX2-5745R | Recombinant Rat SRPX2 Protein | +Inquiry |
SRPX2-702HF | Recombinant Full Length Human SRPX2 Protein, GST-tagged | +Inquiry |
Srpx2-1376M | Recombinant Mouse Srpx2 Protein, His-SUMO/MYC-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRPX2-1471HCL | Recombinant Human SRPX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRPX2 Products
Required fields are marked with *
My Review for All SRPX2 Products
Required fields are marked with *
0
Inquiry Basket