Recombinant Human SRPX2 protein, GST-tagged
Cat.No. : | SRPX2-20H |
Product Overview : | Recombinant Human SRPX2(1 a.a. - 465 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 465 a.a. |
Description : | This gene encodes a secreted protein that contains three sushi repeat motifs. The encoded protein may play a role in the development of speech and language centers in the brain. This protein may also be involved in angiogenesis. Mutations in this gene are the cause of bilateral perisylvian polymicrogyria, rolandic epilepsy, speech dyspraxia and mental retardation. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 79.4 kDa |
AA Sequence : | MASQLTQRGALFLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPK GGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCS SGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRG PEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQG TPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRH VTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLS NQELTQRREQRDICE |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SRPX2 sushi-repeat containing protein, X-linked 2 [ Homo sapiens ] |
Official Symbol | SRPX2 |
Synonyms | SRPX2; sushi-repeat containing protein, X-linked 2; sushi repeat containing protein, X linked 2; sushi repeat-containing protein SRPX2; SRPUL; sushi-repeat-containing protein, X-linked 2; sushi-repeat protein up-regulated in leukemia; BPP; CBPS; PMGX; RESDX; |
Gene ID | 27286 |
mRNA Refseq | NM_014467 |
Protein Refseq | NP_055282 |
MIM | 300642 |
UniProt ID | O60687 |
Chromosome Location | Xq21.33-q23 |
Pathway | protein binding; receptor binding; |
Function | SRPX2;sushi-repeat containing protein, X-linked 2;sushi repeat containing protein, X linked 2;sushi repeat-containing protein SRPX2;SRPUL;sushi-repeat-containing protein, X-linked 2;sushi-repeat protein up-regulated in leukemia;BPP;CBPS;PMGX;RESDX;NP_055282;NM_014467;O60687;OTTHUMP00000023653;HGNC: 30668;Entrez Gene: 27286;Ensembl: ENSG00000102359;OMIM: 300642;UniProtKB: O60687;SRPX2_HUMAN; |
◆ Recombinant Proteins | ||
SRPX2-2759M | Recombinant Mouse SRPX2 Protein (26-468 aa), His-Myc-tagged | +Inquiry |
SRPX2-2962H | Recombinant Human SRPX2 protein, His/sumo/Myc-tagged | +Inquiry |
Srpx2-1376M | Recombinant Mouse Srpx2 Protein, His-SUMO/MYC-tagged | +Inquiry |
SRPX2-702HF | Recombinant Full Length Human SRPX2 Protein, GST-tagged | +Inquiry |
SRPX2-2960H | Recombinant Human SRPX2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRPX2-1471HCL | Recombinant Human SRPX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SRPX2 Products
Required fields are marked with *
My Review for All SRPX2 Products
Required fields are marked with *