"SRPX2" Related Products

Expand
Expand

Recombinant Human SRPX2 protein, GST-tagged

Cat.No.: SRPX2-20H
Product Overview: Recombinant Human SRPX2(1 a.a. - 465 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: This gene encodes a secreted protein that contains three sushi repeat motifs. The encoded protein may play a role in the development of speech and language centers in the brain. This protein may also be involved in angiogenesis. Mutations in this gene are the cause of bilateral perisylvian polymicrogyria, rolandic epilepsy, speech dyspraxia and mental retardation.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 79.4 kDa
Protein length: 1 a.a. - 465 a.a.
AA Sequence: MASQLTQRGALFLLFFLTPAVTPTWYAGSGYYPDESYNEVYAEEVPQAPALDYRVPRWCYTLNIQDGEATCYSPK GGNYHSSLGTRCELSCDRGFRLIGRRSVQCLPSRRWSGTAYCRQMRCHALPFITSGTYTCTNGVLLDSRCDYSCS SGYHLEGDRSRICMEDGRWSGGEPVCVDIDPPKIRCPHSREKMAEPEKLTARVYWDPPLVKDSADGTITRVTLRG PEPGSHFPEGEHVIRYTAYDRAYNRASCKFIVKVQVRRCPTLKPPQHGYLTCTSAGDNYGATCEYHCDGGYDRQG TPSRVCQSSRQWSGSPPICAPMKINVNVNSAAGLLDQFYEKQRLLIISAPDPSNRYYKMQISMLQQSTCGLDLRH VTIIELVGQPPQEVGRIREQQLSANIIEELRQFQRLTRSYFNMVLIDKQGIDRDRYMEPVTPEEIFTFIDDYLLS NQELTQRREQRDICE
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: SRPX2 sushi-repeat containing protein, X-linked 2 [ Homo sapiens ]
Official Symbol: SRPX2
Synonyms: SRPX2; sushi-repeat containing protein, X-linked 2; sushi repeat containing protein, X linked 2; sushi repeat-containing protein SRPX2; SRPUL; sushi-repeat-containing protein, X-linked 2; sushi-repeat protein up-regulated in leukemia; BPP; CBPS; PMGX; RESDX;
Gene ID: 27286
mRNA Refseq: NM_014467
Protein Refseq: NP_055282
MIM: 300642
UniProt ID: O60687
Chromosome Location: Xq21.33-q23
Pathway: protein binding; receptor binding;
Function: SRPX2;sushi-repeat containing protein, X-linked 2;sushi repeat containing protein, X linked 2;sushi repeat-containing protein SRPX2;SRPUL;sushi-repeat-containing protein, X-linked 2;sushi-repeat protein up-regulated in leukemia;BPP;CBPS;PMGX;RESDX;NP_055282;NM_014467;O60687;OTTHUMP00000023653;HGNC: 30668;Entrez Gene: 27286;Ensembl: ENSG00000102359;OMIM: 300642;UniProtKB: O60687;SRPX2_HUMAN;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.