Recombinant O. volvulus OV-16 antigen Protein, His-tagged
| Cat.No. : | OV16-1314O |
| Product Overview : | Recombinant Onchocerca volvulus OV-16 antigen (17-197aa) was expressed in E. coli with N-terminal His tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | O.volvulus |
| Source : | E.coli |
| Tag : | His |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 24.0 kDa |
| AA Sequence : | KISAENANCKKCTPMLVDSAFKEHGIVPDVVSTAPTKLVNVSYNNLTVNLGNELTPTQVKNQPTKVSWDA EPGALYTLVMTDPDAPSRKNPVFREWHHWLIINISGQNVSSGTVLSDYIGSGPRKGTGLHRYVFLVYKQP GSITDTQHGGNRRNFKVMDFANKHHLGNPVAGNFFQAKHED |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | OV-16 antigen |
| Official Symbol | OV-16 antigen |
| Synonyms | OV-16 antigen; OV16 |
| UniProt ID | P31729 |
| ◆ Recombinant Proteins | ||
| OV16-1314O | Recombinant O. volvulus OV-16 antigen Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All OV-16 antigen Products
Required fields are marked with *
My Review for All OV-16 antigen Products
Required fields are marked with *
