Recombinant Oncorhynchus Mykiss PLP Protein (150-218 aa), His-tagged
| Cat.No. : | PLP-727O |
| Product Overview : | Recombinant Oncorhynchus Mykiss PLP Protein (150-218 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Oncorhynchus Mykiss |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 150-218 aa |
| Description : | This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 11.7 kDa |
| AA Sequence : | PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | plp myelin proteolipid protein [ Oncorhynchus mykiss (rainbow trout) ] |
| Official Symbol | PLP |
| Gene ID | 100136749 |
| mRNA Refseq | NM_001124701 |
| Protein Refseq | NP_001118173 |
| UniProt ID | P79826 |
| ◆ Recombinant Proteins | ||
| RFL16260OF | Recombinant Full Length Oncorhynchus Mykiss Myelin Proteolipid Protein(Plp) Protein, His-Tagged | +Inquiry |
| PLP-727O | Recombinant Oncorhynchus Mykiss PLP Protein (150-218 aa), His-tagged | +Inquiry |
| plp-5497O | Recombinant Oncor plp protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PLP-21 | Native Mouse/Rat PLP (139-151) Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLP Products
Required fields are marked with *
My Review for All PLP Products
Required fields are marked with *
