Recombinant Oncorhynchus Mykiss PLP Protein (150-218 aa), His-tagged

Cat.No. : PLP-727O
Product Overview : Recombinant Oncorhynchus Mykiss PLP Protein (150-218 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Oncorhynchus Mykiss
Source : E.coli
Tag : His
Protein Length : 150-218 aa
Description : This is the major myelin protein from the central nervous syst. It plays an important role in the formation or maintenance of the multilamellar structure of myelin. May be involved in neuron and glial cell differentiation.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 11.7 kDa
AA Sequence : PSSSSLIWHRPATTSTSWTETTPSINQHGWICMDARQYGLLPWNAMPGKACGMTLASICKTKEFFVTYD
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name plp myelin proteolipid protein [ Oncorhynchus mykiss (rainbow trout) ]
Official Symbol PLP
Gene ID 100136749
mRNA Refseq NM_001124701
Protein Refseq NP_001118173
UniProt ID P79826

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLP Products

Required fields are marked with *

My Review for All PLP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon