Recombinant P. aeruginosa ampC Protein, His-SUMO-tagged
Cat.No. : | ampC-1119P |
Product Overview : | Recombinant Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) ampC Protein (27-397aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | P.aeruginosa |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 27-397 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 56.7 kDa |
AA Sequence : | GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Publications : |
Multiplexed screen identifies a Pseudomonas aeruginosa-specific small molecule targeting the outer membrane protein OprH and its interaction with LPS (2024)
|
Gene Name | ampC beta-lactamase [ Pseudomonas aeruginosa PAO1 ] |
Official Symbol | ampC |
Synonyms | Beta-lactamase; ampC; EC= 3.5.2.6; Cephalosporinase |
Gene ID | 878149 |
Protein Refseq | NP_252799.1 |
UniProt ID | P24735 |
◆ Recombinant Proteins | ||
ampC-1119P | Recombinant P. aeruginosa ampC Protein, His-SUMO-tagged | +Inquiry |
ampC-4176E | Recombinant Escherichia coli ampC protein, His-SUMO-tagged | +Inquiry |
ampC-967E | Active Recombinant E. coli AmpC protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ampC Products
Required fields are marked with *
My Review for All ampC Products
Required fields are marked with *