| Cat.No. : | ampC-1119P |
| Product Overview : | Recombinant Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) ampC Protein (27-397aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
| Source : | E. coli |
| Species : | P. aeruginosa |
| Tag : | His-SUMO |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 56.7 kDa |
| AA Sequence : | GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Figure : |
|
| Gene Name : | ampC beta-lactamase [ Pseudomonas aeruginosa PAO1 ] |
| Official Symbol : | ampC |
| Synonyms : | Beta-lactamase; ampC; EC= 3.5.2.6; Cephalosporinase |
| Gene ID : | 878149 |
| Protein Refseq : | NP_252799.1 |
| UniProt ID : | P24735 |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All ampC Products
Download Datasheet