"ampC" Related Products

Recombinant P. aeruginosa ampC Protein, His-SUMO-tagged

Cat.No. : ampC-1119P
Product Overview : Recombinant Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) ampC Protein (27-397aa) was expressed in E. coli with N-terminal His-SUMO-tag.
Source : E. coli
Species : P. aeruginosa
Tag : His-SUMO
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 56.7 kDa
AA Sequence : GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Figure :

Gene Name : ampC beta-lactamase [ Pseudomonas aeruginosa PAO1 ]
Official Symbol : ampC
Synonyms : Beta-lactamase; ampC; EC= 3.5.2.6; Cephalosporinase
Gene ID : 878149
Protein Refseq : NP_252799.1
UniProt ID : P24735

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.