Recombinant P. aeruginosa ampC Protein, His-SUMO-tagged

Cat.No. : ampC-1119P
Product Overview : Recombinant Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) ampC Protein (27-397aa) was expressed in E. coli with N-terminal His-SUMO-tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : P.aeruginosa
Source : E.coli
Tag : His&SUMO
Protein Length : 27-397 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 56.7 kDa
AA Sequence : GEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Publications :
Multiplexed screen identifies a Pseudomonas aeruginosa-specific small molecule targeting the outer membrane protein OprH and its interaction with LPS (2024)
Gene Name ampC beta-lactamase [ Pseudomonas aeruginosa PAO1 ]
Official Symbol ampC
Synonyms Beta-lactamase; ampC; EC= 3.5.2.6; Cephalosporinase
Gene ID 878149
Protein Refseq NP_252799.1
UniProt ID P24735

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ampC Products

Required fields are marked with *

My Review for All ampC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon