Recombinant Pig CD3E protein, His-tagged

• Cat.No.: CD3E-6454P
• Product Overview: Recombinant Pig CD3E protein(Q7YRN2)(22-116aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Pig
• Source: E.coli
• Tag: His
• Protein Length: 22-116aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 15.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: QEDIERPDEDTQKTFKVSISGDKVELTCPEDPESEKMTWKRNDMQIYESYDNYMLLESFSEVENSGYYTCTVGEKTSHRLYLKARVCENCVEVDL

Gene Information

• Gene Name: CD3E CD3e molecule, epsilon (CD3-TCR complex) [ Sus scrofa ]
• Official Symbol: CD3E
• Synonyms: CD3E; CD3e molecule, epsilon (CD3-TCR complex); T-cell surface glycoprotein CD3 epsilon chain; CD3 epsilon subunit; CD3
• Gene ID: 397455
• mRNA Refseq: NM_214227
• Protein Refseq: NP_999392