Recombinant Potato Leafroll Virus ORF3 Protein (1-208 aa), His-tagged

• Cat.No.: ORF3-2025P
• Product Overview: Recombinant Potato Leafroll Virus (strain Potato/Canada/Rowhani/1979) (PLrV) ORF3 Protein (1-208 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Microbiology. Protein Description: Full Length.

Specification

• Species: Potato Leafroll Virus
• Source: E.coli
• Tag: His
• Protein Length: 1-208 aa
• Description: Major capsid protein.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 27.2 kDa
• AA Sequence: MSTVVVKGNVNGGVQQPRRRRRQSLRRRANRVQPVVMVTAPGQPRRRRRRRGGNRRSRRTGVPRGRGSSETFVFTKDNLVGNSQGSFTFGPSLSDCPAFKDGILKAYHEYKITSILLQFVSEASSTSSGSIAYELDPHCKVSSLQSYVNKFQITKGGAKTYQARMINGVEWHDSSEDQCRILWKGNGKSSDPAGSFRVTIRVALQNPK
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: ORF3; Coat protein Short name: CP
• UniProt ID: P17521