Recombinant PvCSPAII-CT Protein
Cat.No. : | PvCSPAII-CT-169 |
Product Overview : | Recombinant PvCSPAII-CT was produced in P. pastoris. |
Availability | October 18, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Source : | P.pastoris |
Tag : | Non |
Form : | 50 mM Tris-HCl pH 8.0, 150 mM NaCl |
AA sequence : | PRENKLKQPGPGDRADGQPAGDRADGQPAGDRAAGQPAGDRAAGQPAGDRADGQPAGDRADGQPAGDRADAPGANQEGGAAAPGANQEGGAAAPGANQEGGAAAAPGANQEGGAAAPGANQEGGAAAPGANQEGGAAAANGAGNQPGANGAGNQPGANGAGNQPGANGAGNQPGANGAGNQPGDRAAGQAAGGNAGGQGQNNEGANAPNEKSVKEYLDKVRATVGTEWTPCSVTCGVGVRVRRRVNAANKKPEDLTLNDLETDVCT |
Purity : | about 95% |
Concentration : | 0.54mg/ml |
◆ Recombinant Proteins | ||
PvCSPAII-CT-169 | Recombinant PvCSPAII-CT Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PvCSPAII-CT Products
Required fields are marked with *
My Review for All PvCSPAII-CT Products
Required fields are marked with *