"PvCSPAII-CT" Related Products

Recombinant PvCSPAII-CT Protein

Cat.No.: PvCSPAII-CT-169
Product Overview: Recombinant PvCSPAII-CT was produced in P. pastoris.
Source: P. pastoris
Form: 50 mM Tris-HCl pH 8.0, 150 mM NaCl
AA sequence: PRENKLKQPGPGDRADGQPAGDRADGQPAGDRAAGQPAGDRAAGQPAGDRADGQPAGDRADGQPAGDRADAPGANQEGGAAAPGANQEGGAAAPGANQEGGAAAAPGANQEGGAAAPGANQEGGAAAPGANQEGGAAAANGAGNQPGANGAGNQPGANGAGNQPGANGAGNQPGANGAGNQPGDRAAGQAAGGNAGGQGQNNEGANAPNEKSVKEYLDKVRATVGTEWTPCSVTCGVGVRVRRRVNAANKKPEDLTLNDLETDVCT
Purity: about 95%
Concentration: 0.54mg/ml

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.