Recombinant PvCSPAII-CT Protein
| Cat.No. : | PvCSPAII-CT-169 |
| Product Overview : | Recombinant PvCSPAII-CT was produced in P. pastoris. |
| Availability | December 14, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | P.pastoris |
| Tag : | Non |
| Form : | 50 mM Tris-HCl pH 8.0, 150 mM NaCl |
| AA sequence : | PRENKLKQPGPGDRADGQPAGDRADGQPAGDRAAGQPAGDRAAGQPAGDRADGQPAGDRADGQPAGDRADAPGANQEGGAAAPGANQEGGAAAPGANQEGGAAAAPGANQEGGAAAPGANQEGGAAAPGANQEGGAAAANGAGNQPGANGAGNQPGANGAGNQPGANGAGNQPGANGAGNQPGDRAAGQAAGGNAGGQGQNNEGANAPNEKSVKEYLDKVRATVGTEWTPCSVTCGVGVRVRRRVNAANKKPEDLTLNDLETDVCT |
| Purity : | about 95% |
| Concentration : | 0.54mg/ml |
| ◆ Recombinant Proteins | ||
| PvCSPAII-CT-169 | Recombinant PvCSPAII-CT Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PvCSPAII-CT Products
Required fields are marked with *
My Review for All PvCSPAII-CT Products
Required fields are marked with *
Recently Viewed
