Recombinant Rat PirB Protein, Biotinylated
Cat.No. : | PirB-01R |
Product Overview : | Biotinylated Recombinant Rat PirB Protein(XP_006228132.1) was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | HEK293 |
Tag : | Non |
Form : | Supplied as a 0.2 μm filtered solution in PBS, pH 7.4 |
Molecular Mass : | ~ 75 kDa, reducing condition. |
AA Sequence : | MTFTFTALLCLGLTLGLWIPVLTGSLPKPILRVQPDSVVSMGTTVTFICEETIGAKQSYLYRNGNLQRRVPKNNQKPTNKTEFLFLNVGHQNAGQYHCSYKSQGKSSDYSEPLELVVTGAYSKPSLSAQTNPVVTSGGYVTLKCEPSHYGHTLILTVEGPQKLSWRQDPQCNYYTENCHVLFYVGPLTSNQRWIFRCYSYETNTPQVWSAPSEPVEILVSGKLQKPTIKAEPGSVIHSGKAMIIWCQGDLDAEIYFLHKEGSHNTQSTQTLQQPGNKAKLFIRPVTQGHAGDYRCYYYSSAGWSEPSDTLELVVTGIYNYHPLMLSGPPSPVVPEGGNVTLHCTSHRYYDKFILIKEDQKFSSSLDTKYISSTGQHQALFVMGPMTPNYSGTFRCYGYYKHTPQLWSEPSNLLKILITGLSKKPSLLSQQGYFLAPGISLTLQCYSDINYGTFALYKVGEADIIQSSSQWTKDGLSMANFTLSHSTGGQYRCYGAHNLSSEWSASSDPLDILITGQLHHVLFLSVMPNSTVHSGENVTLMCWSTYSVDTFILSKEGSGQPPLRLKSKIQDQQYQSEFSMSGVTSKLSGTYRCYGSHDSSLYLLSFASAPVELIVSGPIRTSDLPPTMSIPPDGLQRYLKAGLNDIFEAQKIEWHEHHHHHHHHHH |
Endotoxin : | Less than 1.0 EU per ug by the LAL method |
Purity : | >85%, by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.24 mg/ml |
Gene Name | Pirb paired Ig-like receptor B [ Rattus norvegicus (Norway rat) ] |
Official Symbol | PirB |
Synonyms | Lilrb3b |
Gene ID | 690955 |
mRNA Refseq | XM_006228070.3 |
Protein Refseq | XP_006228132.1 |
UniProt ID | C0HJX3 |
◆ Recombinant Proteins | ||
Pirb-7061M | Recombinant Mouse Pirb protein, His & T7-tagged | +Inquiry |
Pirb-285M | Active Recombinant Mouse Pirb, His-tagged | +Inquiry |
Pirb-6760M | Recombinant Mouse Pirb Protein, His (Fc)-Avi-tagged | +Inquiry |
PirB-01R | Recombinant Rat PirB Protein, Biotinylated | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PirB Products
Required fields are marked with *
My Review for All PirB Products
Required fields are marked with *
0
Inquiry Basket