Recombinant Rat PirB Protein, Biotinylated

Cat.No. : PirB-01R
Product Overview : Biotinylated Recombinant Rat PirB Protein(XP_006228132.1) was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : HEK293
Tag : Non
Form : Supplied as a 0.2 μm filtered solution in PBS, pH 7.4
Molecular Mass : ~ 75 kDa, reducing condition.
AA Sequence : MTFTFTALLCLGLTLGLWIPVLTGSLPKPILRVQPDSVVSMGTTVTFICEETIGAKQSYLYRNGNLQRRVPKNNQKPTNKTEFLFLNVGHQNAGQYHCSYKSQGKSSDYSEPLELVVTGAYSKPSLSAQTNPVVTSGGYVTLKCEPSHYGHTLILTVEGPQKLSWRQDPQCNYYTENCHVLFYVGPLTSNQRWIFRCYSYETNTPQVWSAPSEPVEILVSGKLQKPTIKAEPGSVIHSGKAMIIWCQGDLDAEIYFLHKEGSHNTQSTQTLQQPGNKAKLFIRPVTQGHAGDYRCYYYSSAGWSEPSDTLELVVTGIYNYHPLMLSGPPSPVVPEGGNVTLHCTSHRYYDKFILIKEDQKFSSSLDTKYISSTGQHQALFVMGPMTPNYSGTFRCYGYYKHTPQLWSEPSNLLKILITGLSKKPSLLSQQGYFLAPGISLTLQCYSDINYGTFALYKVGEADIIQSSSQWTKDGLSMANFTLSHSTGGQYRCYGAHNLSSEWSASSDPLDILITGQLHHVLFLSVMPNSTVHSGENVTLMCWSTYSVDTFILSKEGSGQPPLRLKSKIQDQQYQSEFSMSGVTSKLSGTYRCYGSHDSSLYLLSFASAPVELIVSGPIRTSDLPPTMSIPPDGLQRYLKAGLNDIFEAQKIEWHEHHHHHHHHHH
Endotoxin : Less than 1.0 EU per ug by the LAL method
Purity : >85%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 ºC. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.24 mg/ml
Conjugation : Biotin
Gene Name Pirb paired Ig-like receptor B [ Rattus norvegicus (Norway rat) ]
Official Symbol PirB
Synonyms Lilrb3b
Gene ID 690955
mRNA Refseq XM_006228070.3
Protein Refseq XP_006228132.1
UniProt ID C0HJX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PirB Products

Required fields are marked with *

My Review for All PirB Products

Required fields are marked with *

0
cart-icon
0
compare icon