Recombinant Rat Reg3g protein, His-tagged
| Cat.No. : | Reg3g-3420R |
| Product Overview : | Recombinant Rat Reg3g protein(P42854)(27-174aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 27-174aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 20.3 kDa |
| AA Sequence : | EDAKEDVPTSRISCPKGSRAYGSYCYALFSVSKSWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSGNSGQNVWIGLHDPTLGQEPNRGGWEWSNADVMNYFNWETNPSSVSGSHCGTLTRASGFLRWRENNCISELPYVCKFKA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Reg3g regenerating islet-derived 3 gamma [ Rattus norvegicus ] |
| Official Symbol | Reg3g |
| Synonyms | REG3G; regenerating islet-derived 3 gamma; regenerating islet-derived protein 3-gamma; REG-3-gamma; reg III-gamma; pancreatitis-associated protein 3; regenerating islet-derived protein 3 gamma; regenerating islet-derived protein III-gamma; Pap3; PAPIII; |
| Gene ID | 24620 |
| mRNA Refseq | NM_173097 |
| Protein Refseq | NP_775120 |
| ◆ Recombinant Proteins | ||
| REG3G-5634H | Recombinant Human REG3G Protein (Glu27-Asp175), N-His tagged | +Inquiry |
| REG3G-4649R | Recombinant Rat REG3G Protein, His (Fc)-Avi-tagged | +Inquiry |
| Reg3g-1283M | Recombinant Mouse Reg3g protein, His & S-tagged | +Inquiry |
| Reg3g-1284R | Recombinant Rat Reg3g protein, His-tagged | +Inquiry |
| Reg3g-919M | Active Recombinant Mouse Reg3g | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| REG3G-2438HCL | Recombinant Human REG3G cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Reg3g Products
Required fields are marked with *
My Review for All Reg3g Products
Required fields are marked with *
