Recombinant Rat Slc17a6 protein, His&Myc-tagged
Cat.No. : | Slc17a6-755R |
Product Overview : | Recombinant Rat Slc17a6 protein(Q9JI12)(499-582aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 499-582aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.1 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATSQENGGWPNGWEKKEEFVQESAQDAYSYKDRDDYS |
Gene Name | Slc17a6 solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 [ Rattus norvegicus ] |
Official Symbol | Slc17a6 |
Synonyms | SLC17A6; solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6; vesicular glutamate transporter 2; differentiation-associated BNPI; solute carrier family 17 member 6; differentation-associated Na-dependent inorganic phosphate cotransporter; differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Dnpi; Vglut2; |
Gene ID | 84487 |
mRNA Refseq | NM_053427 |
Protein Refseq | NP_445879 |
◆ Recombinant Proteins | ||
Slc17a6-3654R | Recombinant Rat Slc17a6 protein, His-tagged | +Inquiry |
SLC17A6-15245M | Recombinant Mouse SLC17A6 Protein | +Inquiry |
SLC17A6-5441R | Recombinant Rat SLC17A6 Protein | +Inquiry |
SLC17A6-8243M | Recombinant Mouse SLC17A6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc17a6-755R | Recombinant Rat Slc17a6 protein, His&Myc-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Slc17a6 Products
Required fields are marked with *
My Review for All Slc17a6 Products
Required fields are marked with *
0
Inquiry Basket