Recombinant Rat Slc17a7 protein, His-tagged
Cat.No. : | Slc17a7-4543R |
Product Overview : | Recombinant Rat Slc17a7 protein(Q62634)(1-63aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-63aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 8.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MEFRQEEFRKLAGRALGRLHRLLEKRQEGAETLELSADGRPVTTHTRDPPVVDCTCFGLPRRY |
Gene Name | Slc17a7 solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7 [ Rattus norvegicus ] |
Official Symbol | Slc17a7 |
Synonyms | SLC17A7; solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7; vesicular glutamate transporter 1; solute carrier family 17 member 7; brain-specific Na-dependent inorganic phosphate cotransporter; brain-specific Na(+)-dependent inorganic phosphate cotransporter; BNPI; Vglut1; |
Gene ID | 116638 |
mRNA Refseq | NM_053859 |
Protein Refseq | NP_446311 |
◆ Recombinant Proteins | ||
Slc17a7-4543R | Recombinant Rat Slc17a7 protein, His-tagged | +Inquiry |
SLC17A7-5101R | Recombinant Rat SLC17A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC17A7-15246M | Recombinant Mouse SLC17A7 Protein | +Inquiry |
SLC17A7-5442R | Recombinant Rat SLC17A7 Protein | +Inquiry |
SLC17A7-8244M | Recombinant Mouse SLC17A7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Slc17a7 Products
Required fields are marked with *
My Review for All Slc17a7 Products
Required fields are marked with *
0
Inquiry Basket