Recombinant Rat Slc17a8 protein, His-tagged
Cat.No. : | Slc17a8-4633R |
Product Overview : | Recombinant Rat Slc17a8 protein(Q7TSF2)(1-76aa), fused with C-terminal His tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | Yeast |
Tag : | His |
Protein Length : | 1-76aa |
Tag : | C-His |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 9.8 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MPFNAFDTFKEKILKPGKEGVKNAVGDSLGILQRKLDGTNEEGDAIELSEEGRPVQTSRARAPVCDCSCCGIPKRY |
Gene Name | Slc17a8 solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8 [ Rattus norvegicus ] |
Official Symbol | Slc17a8 |
Synonyms | SLC17A8; solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 8; vesicular glutamate transporter 3; solute carrier family 17 member 8; Vglut3; |
Gene ID | 266767 |
mRNA Refseq | NM_153725 |
Protein Refseq | NP_714947 |
◆ Recombinant Proteins | ||
SLC17A8-5443R | Recombinant Rat SLC17A8 Protein | +Inquiry |
SLC17A8-5102R | Recombinant Rat SLC17A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC17A8-5231Z | Recombinant Zebrafish SLC17A8 | +Inquiry |
Slc17a8-754R | Recombinant Rat Slc17a8 protein, His-tagged | +Inquiry |
Slc17a8-4633R | Recombinant Rat Slc17a8 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Slc17a8 Products
Required fields are marked with *
My Review for All Slc17a8 Products
Required fields are marked with *
0
Inquiry Basket