Recombinant Rat Slc25a18 Full Length Transmembrane protein, His-tagged

Cat.No. : Slc25a18-1021R
Product Overview : Recombinant Rat Slc25a18 protein(Q505J6)(1-320aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : His
Protein Length : 1-320aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 35.7 kDa
AA Sequence : MIACRMSSQDLSITAKLINGGIAGLVGVTCVFPIDLAKTRLQNQQGKDVYKGMTDCLVKTARAEGFLGMYRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGICQVVITCPMEMLKIQLQDAGRLAVCQQASASATPTSRPYSTGSTSTHRRPSATLIAWELLRTQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQLGVSELTGKASFTHSFVAGCAAGSVSAVAVTPLDVLKTRIQTLKKGLGEDTYRGVTDCARKLWTQEGAAAFMKGAGCRALVIAPLFGIAQGVYFIGIGERILKCFE-
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Slc25a18 solute carrier family 25 (mitochondrial carrier), member 18 [ Rattus norvegicus ]
Official Symbol Slc25a18
Synonyms SLC25A18; solute carrier family 25 (mitochondrial carrier), member 18; mitochondrial glutamate carrier 2; GC-2; glutamate/H(+) symporter 2; glutamate carrier 2, mitochondrial; solute carrier family 25 member 18; MGC105602;
Gene ID 681896
mRNA Refseq NM_001044280
Protein Refseq NP_001037745

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Slc25a18 Products

Required fields are marked with *

My Review for All Slc25a18 Products

Required fields are marked with *

0
cart-icon