Recombinant Rat Slc25a18 Full Length Transmembrane protein, His-tagged
Cat.No. : | Slc25a18-1021R |
Product Overview : | Recombinant Rat Slc25a18 protein(Q505J6)(1-320aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-320aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 35.7 kDa |
AA Sequence : | MIACRMSSQDLSITAKLINGGIAGLVGVTCVFPIDLAKTRLQNQQGKDVYKGMTDCLVKTARAEGFLGMYRGAAVNLTLVTPEKAIKLAANDFLRQLLMQDGTQRNLKMEMLAGCGAGICQVVITCPMEMLKIQLQDAGRLAVCQQASASATPTSRPYSTGSTSTHRRPSATLIAWELLRTQGLSGLYRGLGATLLRDIPFSIIYFPLFANLNQLGVSELTGKASFTHSFVAGCAAGSVSAVAVTPLDVLKTRIQTLKKGLGEDTYRGVTDCARKLWTQEGAAAFMKGAGCRALVIAPLFGIAQGVYFIGIGERILKCFE- |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Slc25a18 solute carrier family 25 (mitochondrial carrier), member 18 [ Rattus norvegicus ] |
Official Symbol | Slc25a18 |
Synonyms | SLC25A18; solute carrier family 25 (mitochondrial carrier), member 18; mitochondrial glutamate carrier 2; GC-2; glutamate/H(+) symporter 2; glutamate carrier 2, mitochondrial; solute carrier family 25 member 18; MGC105602; |
Gene ID | 681896 |
mRNA Refseq | NM_001044280 |
Protein Refseq | NP_001037745 |
◆ Recombinant Proteins | ||
SLC25A18-5470R | Recombinant Rat SLC25A18 Protein | +Inquiry |
RFL30924RF | Recombinant Full Length Rat Mitochondrial Glutamate Carrier 2(Slc25A18) Protein, His-Tagged | +Inquiry |
RFL26402HF | Recombinant Full Length Human Mitochondrial Glutamate Carrier 2(Slc25A18) Protein, His-Tagged | +Inquiry |
SLC25A18-2718H | Recombinant Human SLC25A18, GST-tagged | +Inquiry |
SLC25A18-15303M | Recombinant Mouse SLC25A18 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A18-1779HCL | Recombinant Human SLC25A18 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc25a18 Products
Required fields are marked with *
My Review for All Slc25a18 Products
Required fields are marked with *