Recombinant Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) VP4 Protein, His-tagged
| Cat.No. : | VP4-321R |
| Product Overview : | Recombinant Rotavirus X (isolate RVX/Human/Bangladesh/NADRV-B219/2002/GXP[X]) VP4 Protein(1-249aa), fused with N-terminal 6xHis tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rotavirus X |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 1-249aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 30.8kDa |
| AA Sequence : | MSLRSLLITTEAVGETTQTSDHQTSFSTRTYNEINDRPSLRVEKDGEKAYCFKNLDPVRYDTRMGEYPFDYGGQSTENNQLQFDLFTKDLMADTDIGLSDDVRDDLKRQIKEYYQQGYRAIFLIRPQNQEQQYIASYSSTNLNFTSQLSVGVNLSVLNKIQENKLHIYSTQPHIPSVGCEMITKIFRTDVDNENSLINYSVPVTVTISVTKATFEDTFVWNQNNDYPNMNYKDLIPAVTKNSIYHDVKR |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| UniProt ID | A9Q1L0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All VP4 Products
Required fields are marked with *
My Review for All VP4 Products
Required fields are marked with *
