Recombinant SARS-CoV Spike protein, His-sumostar-tagged
| Cat.No. : | Spike-4547S |
| Product Overview : | Recombinant SARS-CoV Spike protein(P59594)(306-527aa), fused to N-terminal His tag and sumostar tag, was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | SARS-CoV |
| Source : | Yeast |
| Tag : | His&SUMO |
| Protein Length : | 306-527aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 39.0 kDa |
| AA Sequence : | RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| ◆ Cell & Tissue Lysates | ||
| Spike-001HCL | Recombinant HCoV-EMC/2012 Spike cell lysate | +Inquiry |
| Spike-1058HCL | Recombinant HCoV-EMC/2012 Spike cell lysate | +Inquiry |
| Spike-001SCL | Recombinant SARS Spike cell lysate | +Inquiry |
| Spike-1741HCL | Recombinant Human coronavirus Spike cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Spike Products
Required fields are marked with *
My Review for All Spike Products
Required fields are marked with *



