Recombinant Sesamum orientale Oleosin Full Length Transmembrane protein, His-tagged
Cat.No. : | Oleosin-305S |
Product Overview : | Recombinant Sesamum orientale Oleosin protein(Q9XHP2)(1-145aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sesamum orientale |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-145aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 16.7 kDa |
AA Sequence : | MAEHYGQQQQTRAPHLQLQPRAQRVVKAATAVTAGGSLLVLSGLTLAGTVIALTIATPLLVIFSPVLVPAVITIFLLGAGFLASGGFGVAALSVLSWIYRYLTGKHPPGADQLESAKTKLASKAREMKDRAEQFSQQPVAGSQTS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
Oleosin-305S | Recombinant Sesamum orientale Oleosin Full Length Transmembrane protein, His-tagged | +Inquiry |
Oleosin-01S | Recombinant Soybean Oleosin Protein, N-10×His tagged | +Inquiry |
Oleosin-5743S | Recombinant Soybean Oleosin protein, His-tagged | +Inquiry |
Oleosin-20G | Recombinant Glycine hispida Oleosin Full Length Transmembrane protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Oleosin Products
Required fields are marked with *
My Review for All Oleosin Products
Required fields are marked with *