"IL8" Related Products

Expand
Expand

Recombinant Sheep IL8 Protein (23-101 aa), His-tagged

Cat.No.: IL8-580S
Product Overview: Recombinant Sheep IL8 Protein (23-101 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
Description: IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Source: E. coli
Species: Sheep
Tag : His
Form: Tris-based buffer, 50% glycerol
Molecular Mass: 13.1 kDa
Protein length: 23-101 aa
AA Sequence: AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name: IL8 interleukin 8 [ Ovis aries ]
Official Symbol: IL8
Synonyms: IL8; interleukin 8; interleukin-8; IL-8;
Gene ID: 443418
mRNA Refseq: NM_001009401
Protein Refseq: NP_001009401
UniProt ID: P36925

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.