Cat.No.:	IL8-580S
Product Overview:	Recombinant Sheep IL8 Protein (23-101 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein.
Description:	IL-8 is a chotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus.
Source:	E. coli
Species:	Sheep
Tag :	His
Form:	Tris-based buffer, 50% glycerol
Molecular Mass:	13.1 kDa
Protein length:	23-101 aa
AA Sequence:	AVLSRMSTELRCQCIKTHSTPFHPKFIKELRVIESGPHCENSEIIVKLTNGKEVCLDPKEKWVQKVVQAFLKRAEKQDP
Purity:	> 90% as determined by SDS-PAGE.
Notes:	Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage:	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration:	A hardcopy of COA with concentration instruction is sent along with the products.

Gene Name:	IL8 interleukin 8 [ Ovis aries ]
Official Symbol:	IL8
Synonyms:	IL8; interleukin 8; interleukin-8; IL-8;
Gene ID:	443418
mRNA Refseq:	NM_001009401
Protein Refseq:	NP_001009401
UniProt ID:	P36925

Online Inquiry