Recombinant Soybean Ferritin-2 (chloroplastic) Protein, His-SUMO-tagged
Cat.No. : | FRI2-1212S |
Product Overview : | Recombinant Soybean Ferritin-2 (chloroplastic) Protein (52-257aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Soybean |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 52-257 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 39.5 kDa |
AA Sequence : | APAPLAGVIFEPFQELKKDYLAVPIAHNVSLARQNYADDSESAINEQINVEYNVSYVYHALFAYFDRDNI ALKGLAKFFKESSEEEREHAEQLIKYQNIRGGRVVLHPITSPPSEFEHSEKGDALYAMELALSLEKLTNE KLLHVHSVAERNNDPQSADFIESEFLYEQVKSIKKIAEYVAQLRLVGKGHGVWHFDQKLLHDEDHV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | SFERH-2 ferritin [ Glycine max (soybean) ] |
Official Symbol | Ferritin-2, chloroplastic |
Synonyms | Fer1-1; Ferritin-2, chloroplastic; EC 1.16.3.1; SFerH-2 |
Gene ID | 547988 |
mRNA Refseq | NM_001250105.2 |
Protein Refseq | NP_001237034.2 |
UniProt ID | Q94IC4 |
◆ Recombinant Proteins | ||
FRI2-1212S | Recombinant Soybean Ferritin-2 (chloroplastic) Protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ferritin-2, chloroplastic Products
Required fields are marked with *
My Review for All Ferritin-2, chloroplastic Products
Required fields are marked with *