Recombinant SPE248 Protein, His-tagged
| Cat.No. : | SPE248-62 |
| Product Overview : | Recombinant SPE248 Protein fused with a His tag. |
| Availability | December 16, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Molecular Mass : | The protein has a calculated MW of 17 kDa. |
| AA Sequence : | MHTVIWSIKIIDSFSGMACLASTVASILPEQSGRQINNSQPSSVARPIKWEAVTAAPLVERAEVKAAQGDTLEKRFGCIDPLVSVDVLNRGNGARGSLLDVNILNGFLKDAQKKSQLTPFSITRQAIPQTYGEHIHRTNCHAEASSVFIHHHHHH |
| Purity : | >90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.2 mg/mL |
| Storage Buffer : | PBS pH7.4 |
| Official Symbol | SPE248 |
| Synonyms | SPE248 |
| ◆ Recombinant Proteins | ||
| SPE248-62 | Recombinant SPE248 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPE248 Products
Required fields are marked with *
My Review for All SPE248 Products
Required fields are marked with *
Recently Viewed
