Recombinant Streptomyces Alboniger PAC Protein (1-199 aa), His-SUMO-tagged

• Cat.No.: PAC-1878S
• Product Overview: Recombinant Streptomyces Alboniger PAC Protein (1-199 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Full Length.

Specification

• Species: Streptomyces Alboniger
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-199 aa
• Description: Detoxification of puromycin.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 37.5 kDa
• AA Sequence: MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIERVTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLAAQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETSAPRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPGA
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Synonyms: pac
• UniProt ID: P13249