Recombinant TBAUK1 Protein
| Cat.No. : | TBAUK1-172 |
| Product Overview : | Recombinant TBAUK1 was produced in Insect cells. |
| Availability | December 23, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | Insect Cells |
| Tag : | Non |
| Form : | Liquid. In Tris-Hcl PH8.0. |
| Molecular Mass : | (Theoretical molecular weight)~36.4kDa |
| AA sequence : | MRSTEVGRVVEDFIVLPPTPKSKWKLSDFELLHKLGGGNYGDVHLASVKDCNFVCALKRLSIKKLADFDIATQLRREIEIAFNTRHKYLLRTYAYFFDETDIYLIMEPCSNGMLYTELNRVKCFAPPTAARYVAQLAEALLYLHQHHILHRDIKPENILLDHNNNIKLADFGWSVHDPDNRRKTSCGTPEYFPPEIVGRQAYDTSADLWCLGIFCYELLVGKTPFVGKDTDQICKNIHSMHFKIPENIPSEAKDLIANLLLRDGSRRLALHRVVNHQFLLKYYYLPNNLQPPTGKRPRLDAEPTAGKENHHHHHH |
| Purity : | >85% as determined by SDS-PAGE |
| Storage : | Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles. |
| Concentration : | 0.3 mg/ml |
| ◆ Recombinant Proteins | ||
| TBAUK1-172 | Recombinant TBAUK1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TBAUK1 Products
Required fields are marked with *
My Review for All TBAUK1 Products
Required fields are marked with *
