Recombinant TBAUK1 Protein

Cat.No. : TBAUK1-172
Product Overview : Recombinant TBAUK1 was produced in Insect cells.
Availability October 24, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : Insect Cells
Tag : Non
Form : Liquid. In Tris-Hcl PH8.0.
Molecular Mass : (Theoretical molecular weight)~36.4kDa
AA sequence : MRSTEVGRVVEDFIVLPPTPKSKWKLSDFELLHKLGGGNYGDVHLASVKDCNFVCALKRLSIKKLADFDIATQLRREIEIAFNTRHKYLLRTYAYFFDETDIYLIMEPCSNGMLYTELNRVKCFAPPTAARYVAQLAEALLYLHQHHILHRDIKPENILLDHNNNIKLADFGWSVHDPDNRRKTSCGTPEYFPPEIVGRQAYDTSADLWCLGIFCYELLVGKTPFVGKDTDQICKNIHSMHFKIPENIPSEAKDLIANLLLRDGSRRLALHRVVNHQFLLKYYYLPNNLQPPTGKRPRLDAEPTAGKENHHHHHH
Purity : >85% as determined by SDS-PAGE
Storage : Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.3 mg/ml

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All TBAUK1 Products

Required fields are marked with *

My Review for All TBAUK1 Products

Required fields are marked with *

0
cart-icon
0
compare icon