"TBAUK1" Related Products

Recombinant TBAUK1 Protein

Cat.No.: TBAUK1-172
Product Overview: Recombinant TBAUK1 was produced in Insect cells.
Source: Insect cells
Form: Liquid. In Tris-Hcl PH8.0.
Molecular Mass: (Theoretical molecular weight)~36.4kDa
AA sequence: MRSTEVGRVVEDFIVLPPTPKSKWKLSDFELLHKLGGGNYGDVHLASVKDCNFVCALKRLSIKKLADFDIATQLRREIEIAFNTRHKYLLRTYAYFFDETDIYLIMEPCSNGMLYTELNRVKCFAPPTAARYVAQLAEALLYLHQHHILHRDIKPENILLDHNNNIKLADFGWSVHDPDNRRKTSCGTPEYFPPEIVGRQAYDTSADLWCLGIFCYELLVGKTPFVGKDTDQICKNIHSMHFKIPENIPSEAKDLIANLLLRDGSRRLALHRVVNHQFLLKYYYLPNNLQPPTGKRPRLDAEPTAGKENHHHHHH
Purity: >85% as determined by SDS-PAGE
Storage: Short Term Storage at +4 centigrade, Long Term, please prepare aliquots with 20% glycerol and store at -20~-80 centigrade. Avoid freeze/thaw cycles.
Concentration: 0.3 mg/ml

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.