Recombinant TOV-Toxoplasma gondii GRA6 protein, GST-tagged
Cat.No. : | GRA6-4284T |
Product Overview : | Recombinant TOV-Toxoplasma gondii GRA6 protein(Q27003)(35-150aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | TOV-Toxoplasma gondii |
Source : | E.coli |
Tag : | GST |
Protein Length : | 35-150aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 38.6 kDa |
AA Sequence : | NSLGGVAVAADSGGVKQTPSETGSSGGQQEAVGTTEDYVNSSAMGGGQGDSLAEDDTTSEAAEGDVDPFPVLANEGKSEARGPSLEERIEEQGTRRRYSSVQEPQAKVPSKRTQKR |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
◆ Recombinant Proteins | ||
GRA6-592T | Recombinant Toxoplasma gondii GRA6 | +Inquiry |
GRA6-4284T | Recombinant TOV-Toxoplasma gondii GRA6 protein, GST-tagged | +Inquiry |
GRA6-272T | Recombinant Toxoplasma Gondii GRA6 protein, His-tagged | +Inquiry |
RFL32795TF | Recombinant Full Length Toxoplasma Gondii Dense Granule Protein 6(Gra6) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRA6 Products
Required fields are marked with *
My Review for All GRA6 Products
Required fields are marked with *