Recombinant Toxoplasma Gondii GRA1 Protein (25-190 aa), His-tagged
| Cat.No. : | GRA1-1576T |
| Product Overview : | Recombinant Toxoplasma Gondii GRA1 Protein (25-190 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | T.gondii |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 25-190 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 19.9 kDa |
| AA Sequence : | AEGGDNQSSAVSDRASLFGLLSGGTGQGLGIGESVDLEMMGNTYRVERPTGNPDLLKIAIKASDGSYSEVGNVNVEEVIDTMKSMQRDEDIFLRALNKGETVEEAIEDVAQAEGLNSEQTLQLEDAVSAVASVVQDEMKVIDDVQQLEKDKQQLKDDIGFLTGERE |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Synonyms | GRA1; Major antigen p24; |
| UniProt ID | P13403 |
| ◆ Recombinant Proteins | ||
| GRA1-889T | Recombinant Toxoplasma gondii GRA1 protein | +Inquiry |
| GRA1-1576T | Recombinant Toxoplasma Gondii GRA1 Protein (25-190 aa), His-tagged | +Inquiry |
| GRA1-3860T | Recombinant Toxoplasma gondii GRA1 protein, His-tagged | +Inquiry |
| GRA1-763T | Recombinant Toxoplasma Gondii GRA1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRA1 Products
Required fields are marked with *
My Review for All GRA1 Products
Required fields are marked with *
