Active GMP Recombinant Human IL36A protein

• Cat.No.: IL36A-4338HG
• Product Overview: Recombinant Human IL36A was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Description: Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. Studies showed IL-36α is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. Notably, IL-36 alpha is the only novel IL-1 family member expressed on T-cells. Recombinant human interleukin-36 alpha contains 158 amino acids residues which is a single non-glycosylated polypeptide and it is 30 % a.a. identical to IL-1ra, and 27 %, 31 %, 36 %, 46 %, 57% and 28 % a.a. identical to IL-1β, IL-36Ra/IL-1F5, IL-37/IL-1F7, IL-36β/IL-1F8, IL-36γ/IL-1F9 and IL-1F10.
• Form: Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 7.4.
• Bio-activity: Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rHuIL-36α at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL.
• Molecular Mass: Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 158 amino acids.
• AA Sequence: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
• Endotoxin: Less than 1 EU/μg of rHuIL-36α, 158a.a. as determined by LAL method.
• Purity: > 95 % by SDS-PAGE and HPLC analyses.
• Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw centigrade centigradeles.
• Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
• Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
• Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.

Gene Information

• Gene Name: IL36A interleukin 36, alpha [ Homo sapiens (human) ]
• Official Symbol: IL36A
• Synonyms: FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON)
• Gene ID: 27179
• mRNA Refseq: NM_014440.2
• Protein Refseq: NP_055255.1
• MIM: 605509
• UniProt ID: Q9UHA7