Active GMP Recombinant Mouse Activin B Protein, His-Tagged
Cat.No. : | Activin B-01M |
Product Overview : | GMP Recombinant Mouse Activin B Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | Activins and inhibins, members of the TGF-beta superfamily, are disulfide-linked dimeric proteins that were originally purified from gonadal fluids as proteins that stimulated or inhibited, respectively, pituitary follicle stimulating hormone (FSH) release. Activin is strongly expressed in wounded skin, and overexpression of activin in epidermis of transgenic mice improves wound healing and enhances scar formation. Activin also regulates the morphogenesis of branching organs such as the prostate, lung, and kidney. There is also evidence showed that lack of activin during development results in neural developmental defects. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <1 ng/mL. |
AA Sequence : | MGLECDGRTSLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGPVNSCCIPTKLSSMSM LYFDDEYNIVKRDVPNMIVEECGCA with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >95% as determined by SDS-PAGE analysis. Purified by Ni-NTA chromatography. |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
◆ Recombinant Proteins | ||
Activin B-16H | Active Recombinant Human Activin B, His-tagged | +Inquiry |
Activin B-58H | Active Recombinant Human Activin B, CF | +Inquiry |
Activin B-59H | Active Recombinant Human Activin B | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Activin B Products
Required fields are marked with *
My Review for All Activin B Products
Required fields are marked with *