| Species : |
Mouse |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
40-113 a.a. |
| Description : |
Predicted to enable chemokine binding activity; chemokine receptor activity; and scavenger receptor activity. Acts upstream of or within negative regulation of cell population proliferation and positive regulation of ERK1 and ERK2 cascade. Predicted to be located in several cellular components, including cell surface; clathrin-coated pit; and endosome. Predicted to be active in external side of plasma membrane. Is expressed in several structures, including adrenal gland; central nervous system; genitourinary system; heart; and hemolymphoid system. Orthologous to human ACKR3 (atypical chemokine receptor 3). |
| Form : |
Lyophilized |
| Bio-activity : |
Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <1 μg/mL. |
| AA Sequence : |
KSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY with polyhistidine tag at the N-terminus |
| Endotoxin : |
<0.1 EU per 1 μg of the protein by the LAL method. |
| Purity : |
>98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Notes : |
Please use within one month after protein reconstitution. |
| Storage : |
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Storage Buffer : |
The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |