Active GMP Recombinant Porcine IL8 Protein, His-Tagged
Cat.No. : | IL8-01P |
Product Overview : | GMP Recombinant Porcine IL8 Protein, His-Tagged was expressed in Escherichia coli cell-derived in an animal component free process under cGMP guidelines. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Tag : | His |
Description : | Interleukin 8 (IL-8 or chemokine (C-X-C motif) ligand 8, CXCL8) is a chemokine produced by macrophages and other cell types such as epithelial cells, airway smooth muscle cells, and endothelial cells. Endothelial cells store IL-8 in their storage vesicles, the Weibel-Palade bodies. In humans, the interleukin-8 protein is encoded by the CXCL8 gene. IL-8 is initially produced as a precursor peptide of 99 amino acids which then undergoes cleavage to create several active IL-8 isoforms. In culture, a 72 amino acid peptide is the major form secreted by macrophages. |
Form : | Lyophilized |
Bio-activity : | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is <5 ng/mL. |
AA Sequence : | MARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ with polyhistidine tag at the C-terminus |
Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
Notes : | Please use within one month after protein reconstitution. |
Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
Gene Name | CXCL8 C-X-C motif chemokine ligand 8 [ Sus scrofa (pig) ] |
Official Symbol | IL8 |
Synonyms | CXCL8; AMCF-I |
Gene ID | 396880 |
mRNA Refseq | NM_213867.1 |
Protein Refseq | NP_999032.1 |
UniProt ID | P22951 |
◆ Recombinant Proteins | ||
IL8-0208H | Active Recombinant Human IL8 protein, His-tagged | +Inquiry |
IL8-154H | Recombinant Human IL8, None tagged | +Inquiry |
IL8-516H | Recombinant Human Interleukin 8, His-tagged | +Inquiry |
IL8-191P | Recombinant Porcine IL8 Protein | +Inquiry |
IL8-172H | Active Recombinant Human IL8 Protein (Ser28-Ser99), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL8-3002HCL | Recombinant Human IL8 cell lysate | +Inquiry |
IL8-3004HCL | Recombinant Human IL8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL8 Products
Required fields are marked with *
My Review for All IL8 Products
Required fields are marked with *
0
Inquiry Basket