Active Recombinant Full Length Human AQP3 Protein, C-Flag-tagged
Cat.No. : | AQP3-289HFL |
Product Overview : | Recombinant Full Length Human AQP3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the water channel protein aquaporin 3. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein, also known as aquaporin 0. Aquaporin 3 is localized at the basal lateral membranes of collecting duct cells in the kidney. In addition to its water channel function, aquaporin 3 has been found to facilitate the transport of nonionic small solutes such as urea and glycerol, but to a smaller degree. It has been suggested that water channels can be functionally heterogeneous and possess water and solute permeation mechanisms. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | In vivo treatment |
Molecular Mass : | 31.4 kDa |
AA Sequence : | MGRQKELVSRCGEMLHIRYRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLG ILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPIYTLAQTLGAFLGAGIVFGLYYDAIWHFADNQLFVSGP NGTAGIFATYPSGHLDMINGFFDQFIGTASLIVCVLAIVDPYNNPVPRGLEAFTVGLVVLVIGTSMGFNS GYAVNPARDFGPRLFTALAGWGSAVFTTGQHWWWVPIVSPLLGSIAGVFVYQLMIGCHLEQPPPSNEEEN VKLAHVKHKEQITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | AQP3 aquaporin 3 (Gill blood group) [ Homo sapiens (human) ] |
Official Symbol | AQP3 |
Synonyms | GIL; AQP-3 |
Gene ID | 360 |
mRNA Refseq | NM_004925.5 |
Protein Refseq | NP_004916.1 |
MIM | 600170 |
UniProt ID | Q92482 |
◆ Recombinant Proteins | ||
RFL6229HF | Recombinant Full Length Human Aquaporin-3(Aqp3) Protein, His-Tagged | +Inquiry |
Aqp3-1671M | Recombinant Mouse Aqp3 Protein, Myc/DDK-tagged | +Inquiry |
AQP3-289HFL | Active Recombinant Full Length Human AQP3 Protein, C-Flag-tagged | +Inquiry |
AQP3-202R | Recombinant Rhesus Macaque AQP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL12661MF | Recombinant Full Length Mouse Aquaporin-3(Aqp3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP3-8767HCL | Recombinant Human AQP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AQP3 Products
Required fields are marked with *
My Review for All AQP3 Products
Required fields are marked with *
0
Inquiry Basket