Active Recombinant Full Length Human ARG2 Protein, C-Flag-tagged
Cat.No. : | ARG2-148HFL |
Product Overview : | Recombinant Full Length Human ARG2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exists (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type II isoform encoded by this gene, is located in the mitochondria and expressed in extra-hepatic tissues, especially kidney. The physiologic role of this isoform is poorly understood; it is thought to play a role in nitric oxide and polyamine metabolism. Transcript variants of the type II gene resulting from the use of alternative polyadenylation sites have been described. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | L-Arginase activity verified in a biochemical assay: Arginase 2 activity was measured in a colorimetric biochemical assay. Arginase 1 catalyzes the conversion of arginine to ornithine and urea. After incubation of the protein in a solution containing arginine, the reaction is stopped, and the urea concentration is measured by a chemical reaction that produces a colored product that absorbs at 430 nm. By measuring the absorbance at 430 nm and comparing to a standard, the specific activity of this preparation of ARG2 was calculated to be approximately 10U/mg. Unit definition: 1 unit of ARG2 converts 1 µmole of L-arginine to ornithine and urea per minute at pH 9.5 and 37 centigrade. |
Molecular Mass : | 36 kDa |
AA Sequence : | MSLRGSLSRLLQTRVHSILKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGD LSFTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVV WVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILK NYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIA EEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPSSPDESENQA RVRITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Arginine and proline metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | ARG2 arginase 2 [ Homo sapiens (human) ] |
Official Symbol | ARG2 |
Synonyms | arginase 2; kidney arginase; L-arginine amidinohydrolase; L-arginine ureahydrolase; nonhepatic arginase |
Gene ID | 384 |
mRNA Refseq | NM_001172.4 |
Protein Refseq | NP_001163.1 |
MIM | 107830 |
UniProt ID | P78540 |
◆ Recombinant Proteins | ||
Arg2-2548M | Recombinant Mouse Arg2 protein, His-SUMO-tagged | +Inquiry |
ARG2-4988H | Recombinant Human ARG2 protein | +Inquiry |
ARG2-4463C | Recombinant Chicken ARG2 | +Inquiry |
ARG2-0403H | Recombinant Human ARG2 Protein (Val23-Ile354), His-tagged | +Inquiry |
ARG2-1186HF | Recombinant Full Length Human ARG2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARG2-8747HCL | Recombinant Human ARG2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARG2 Products
Required fields are marked with *
My Review for All ARG2 Products
Required fields are marked with *