Active Recombinant Full Length Human CAPRIN1 Protein, C-Flag-tagged
Cat.No. : | CAPRIN1-283HFL |
Product Overview : | Recombinant Full Length Human CAPRIN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | May regulate the transport and translation of mRNAs of proteins involved in synaptic plasticity in neurons and cell proliferation and migration in multiple cell types. Binds directly and selectively to MYC and CCND2 RNAs. In neuronal cells, directly binds to several mRNAs associated with RNA granules, including BDNF, CAMK2A, CREB1, MAP2, NTRK2 mRNAs, as well as to GRIN1 and KPNB1 mRNAs, but not to rRNAs. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Co-immunoprecipitation |
Molecular Mass : | 78.2 kDa |
AA Sequence : | MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGVIDKKLRNLEK KKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALSQDIQKTIKKTARREQLMREE AEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSEEELSLLDEFYKLVDPERDMSLRLNEQYEHA SIHLWDLLEGKEKPVCGTTYKVLKEIVERVFQSNYFDSTHNHQNGLCEEEEAASAPAVEDQVPEAEPEPA EEYTEQSEVESTEYVNRQFMAETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQA DPLVRRQRVQDLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQP NQVPVQPEATQVPLVSSTSEGYTASQPLYQPSHATEQRPQKEPIDQIQATISLNTDQTTASSSLPAASQP QVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQNQYQASYNQSFSSQPHQVEQTE LQQEQLQTVVGTYHGSPDQSHQVTGNHQQPPQQNTGFPRSNQPYYNSRGVSRGGSRGARGLMNGYRGPAN GFRGGYDGYRPSFSNTPNSGYTQSQFSAPRDYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGM PQMNTQQVNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CAPRIN1 cell cycle associated protein 1 [ Homo sapiens (human) ] |
Official Symbol | CAPRIN1 |
Synonyms | M11S1; GPIAP1; RNG105; GPIP137; GRIP137; p137GPI |
Gene ID | 4076 |
mRNA Refseq | NM_005898.5 |
Protein Refseq | NP_005889.3 |
MIM | 601178 |
UniProt ID | Q14444 |
◆ Recombinant Proteins | ||
CAPRIN1-2782H | Recombinant Human CAPRIN1 Protein (2-709 aa), His-tagged | +Inquiry |
CAPRIN1-1029R | Recombinant Rat CAPRIN1 Protein (2-707 aa), His-SUMO-tagged | +Inquiry |
CAPRIN1-026H | Recombinant Human CAPRIN1 Protein, MYC/DDK-tagged | +Inquiry |
Caprin1-1955M | Recombinant Mouse Caprin1 Protein, Myc/DDK-tagged | +Inquiry |
CAPRIN1-0376H | Recombinant Human CAPRIN1 Protein, GST-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAPRIN1-7857HCL | Recombinant Human CAPRIN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CAPRIN1 Products
Required fields are marked with *
My Review for All CAPRIN1 Products
Required fields are marked with *
0
Inquiry Basket