Active Recombinant Full Length Human DCTN2 Protein, C-Flag-tagged
Cat.No. : | DCTN2-364HFL |
Product Overview : | Recombinant Full Length Human DCTN2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a 50-kD subunit of dynactin, a macromolecular complex consisting of 10-11 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, chromosome movement, nuclear positioning, and axonogenesis. This subunit is present in 4-5 copies per dynactin molecule. It contains three short alpha-helical coiled-coil domains that may mediate association with self or other dynactin subunits. It may interact directly with the largest subunit (p150) of dynactin and may affix p150 in place. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Co-immunoprecipitation |
Molecular Mass : | 44.6 kDa |
AA Sequence : | MADPKYADLPGIARNEPDVYETSDLPEDDQAEFDAFAQELEELTSTSVEHIIVNPNAAYDKFKDKRVGTK GLDFSDRIGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKTTVKESATEEKLTP VLLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGALAKRLLLQLEATKNSKGGSGGKTTGTPPDSSLV TYELHSRPEQDKFSQAAKVAELEKRLTELETAVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALDLAV LDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPIASTLPELVQRLVTIKQLHEQAMQ FGQLLTHLDTTQQMIANSLKDNTTLLTQVQTTMRENLATVEGNFASIDERMKKLGKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Huntington's disease |
Full Length : | Full L. |
Gene Name | DCTN2 dynactin subunit 2 [ Homo sapiens (human) ] |
Official Symbol | DCTN2 |
Synonyms | RBP50; DCTN50; HEL-S-77; DYNAMITIN |
Gene ID | 10540 |
mRNA Refseq | NM_006400.5 |
Protein Refseq | NP_006391.1 |
MIM | 607376 |
UniProt ID | Q13561 |
◆ Recombinant Proteins | ||
DCTN2-2939HF | Recombinant Full Length Human DCTN2 Protein, GST-tagged | +Inquiry |
DCTN2-26061TH | Recombinant Human DCTN2, His-tagged | +Inquiry |
DCTN2-1801R | Recombinant Rat DCTN2 Protein | +Inquiry |
DCTN2-2490H | Recombinant human DCTN2, His-tagged | +Inquiry |
DCTN2-2450H | Recombinant human DCTN2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DCTN2-7042HCL | Recombinant Human DCTN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All DCTN2 Products
Required fields are marked with *
My Review for All DCTN2 Products
Required fields are marked with *
0
Inquiry Basket