Active Recombinant Full Length Human FMOD Protein, C-Flag-tagged
Cat.No. : | FMOD-131HFL |
Product Overview : | Recombinant Full Length Human FMOD Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Fibromodulin belongs to the family of small interstitial proteoglycans. The encoded protein possesses a central region containing leucine-rich repeats with 4 keratan sulfate chains, flanked by terminal domains containing disulphide bonds. Owing to the interaction with type I and type II collagen fibrils and in vitro inhibition of fibrillogenesis, the encoded protein may play a role in the assembly of extracellular matrix. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix. Sequence variations in this gene may be associated with the pathogenesis of high myopia. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Cell treatment |
Molecular Mass : | 41.2 kDa |
AA Sequence : | MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPSP PDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQ ITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHN EIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSL TNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRL DGNEIKRSAMPADAPLCLRLASLIEITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | FMOD fibromodulin [ Homo sapiens (human) ] |
Official Symbol | FMOD |
Synonyms | FM; SLRR2E |
Gene ID | 2331 |
mRNA Refseq | NM_002023.5 |
Protein Refseq | NP_002014.2 |
MIM | 600245 |
UniProt ID | Q06828 |
◆ Recombinant Proteins | ||
Fmod-3057M | Recombinant Mouse Fmod Protein, Myc/DDK-tagged | +Inquiry |
FMOD-82H | Active Recombinant Human FMOD protein, His-tagged | +Inquiry |
FMOD-12947H | Recombinant Human FMOD, GST-tagged | +Inquiry |
FMOD-912H | Recombinant Human FMOD protein, His-tagged | +Inquiry |
FMOD-1732R | Recombinant Rhesus monkey FMOD Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FMOD-6180HCL | Recombinant Human FMOD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FMOD Products
Required fields are marked with *
My Review for All FMOD Products
Required fields are marked with *
0
Inquiry Basket