Active Recombinant Full Length Human FUS Protein, C-Flag-tagged
Cat.No. : | FUS-10HFL |
Product Overview : | Recombinant Full Length Human FUS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Transmission electron microscopy Co-immunoprecipitation In vitro kinase assay inhibitor |
Molecular Mass : | 53.2 kDa |
AA Sequence : | MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQSQNTGYGTQS TPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSSSYGQPQSGSYSQQPSYGGQQ QSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQDQSSMSSGGGSGGGYGNQDQSGGGGSGGYGQ QDRGGRGRGGSGGGGGGGGGGYNRSSGGYEPRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQD NSDNNTIFVQGLGENVTIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAA IDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGD RGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Stem cell - Pluripotency |
Full Length : | Full L. |
Gene Name | FUS FUS RNA binding protein [ Homo sapiens (human) ] |
Official Symbol | FUS |
Synonyms | TLS; ALS6; ETM4; FUS1; POMP75; altFUS; HNRNPP2 |
Gene ID | 2521 |
mRNA Refseq | NM_004960.4 |
Protein Refseq | NP_004951.1 |
MIM | 137070 |
UniProt ID | P35637 |
◆ Recombinant Proteins | ||
FUS-947H | Recombinant Human FUS Protein, His (Fc)-Avi-tagged | +Inquiry |
FUS-3533H | Recombinant Human FUS protein, His&Myc-tagged | +Inquiry |
FUS-3391M | Recombinant Mouse FUS Protein, His (Fc)-Avi-tagged | +Inquiry |
FUS-30143TH | Recombinant Human FUS, His-tagged | +Inquiry |
FUS-461H | Recombinant Human FUS Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FUS-6118HCL | Recombinant Human FUS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FUS Products
Required fields are marked with *
My Review for All FUS Products
Required fields are marked with *
0
Inquiry Basket